KEGG   Homo sapiens (human): 127623
Entry
127623            CDS       T01001                                 

Gene name
OR2B11
Definition
(RefSeq) olfactory receptor family 2 subfamily B member 11
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    127623 (OR2B11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    127623 (OR2B11)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    127623 (OR2B11)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srsx 7TM_GPCR_Srx DUF2852
Other DBs
NCBI-GeneID: 127623
NCBI-ProteinID: NP_001004492
HGNC: 31249
Ensembl: ENSG00000177535
Vega: OTTHUMG00000040572
Pharos: Q5JQS5(Tdark)
UniProt: Q5JQS5 A0A126GVY5
Position
1q44
AA seq 317 aa
MKSDNHSFLGDSPKAFILLGVSDRPWLELPLFVVLLLSYVLAMLGNVAIILASRVDPQLH
SPMYIFLSHLSFLDLCYTTTTVPQMLVNMGSSQKTISYGGCTVQYAVFHWLGCTECIVLA
AMALDRYVAICKPLHYAVLMHRALCQQLVALAWLSGFGNSFVQVVLTVQLPFCGRQVLNN
FFCEVPAVIKLSCADTAVNDTILAVLVAFFVLVPLALILLSYGFIARAVLRIQSSKGRHK
AFGTCSSHLMIVSLFYLPAIYMYLQPPSSYSQEQGKFISLFYSIITPTLNPFTYTLRNKD
MKGALRRLLARIWRLCG
NT seq 954 nt   +upstreamnt  +downstreamnt
atgaaaagtgacaaccatagcttcttaggggactcccctaaagccttcatccttctgggt
gtgtctgacaggccgtggctggaactccctctctttgtggtcctcctgctgtcctatgtg
ctggccatgttggggaacgtcgccatcatcctggcatcccgggtggatcctcaactccac
agccccatgtacatcttcctcagtcacctgtccttcctggacctctgctacaccaccacg
acagtccctcagatgctggtcaacatgggcagttcccagaagaccatcagctatggaggc
tgcactgtgcaatatgcagtcttccactggctgggatgcacggagtgcatcgtcctggcc
gccatggccctggaccgctacgtggccatctgcaagcccctgcactatgccgttctcatg
caccgtgctctctgtcagcagctcgtggctctggcctggctcagtggcttcggcaactcc
ttcgtgcaggtggtcctgacggtgcaattgccattctgcgggcggcaggtgctgaacaac
tttttctgtgaggtgccggccgtgatcaagctgtcgtgtgctgacaccgctgtgaatgac
accatactggctgtgctggtggccttcttcgtgttggtgcccctggctctcatccttctc
tcctatggctttattgcccgggcagtgctcaggatccagtcctccaagggacgacacaag
gcctttgggacgtgttcctcccacctgatgatcgtctccctcttctacctacctgcgatt
tacatgtatctgcagcccccttccagctactcccaagagcagggcaaatttatttctctc
ttctattccataatcacccccactctcaatcccttcacctacaccctgagaaataaagat
atgaagggggctctgaggagacttctggccaggatctggaggctctgtggatga

DBGET integrated database retrieval system