KEGG   Homo sapiens (human): 127833Help
Entry
127833            CDS       T01001                                 

Gene name
SYT2, CMS7, MYSPC, SytII
Definition
(RefSeq) synaptotagmin 2
  KO
K19902  synaptotagmin-2
Organism
hsa  Homo sapiens (human)
Disease
H00770  Congenital myasthenic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    127833 (SYT2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    127833 (SYT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2 CEP76-C2 TMEM52 MAP17 PI3K_C2 FAM176 EphA2_TM LYRIC Comm
Motif
Other DBs
NCBI-GeneID: 127833
NCBI-ProteinID: NP_001129976
OMIM: 600104
HGNC: 11510
Ensembl: ENSG00000143858
Vega: OTTHUMG00000041388
Pharos: Q8N9I0(Tbio)
UniProt: Q8N9I0 A0A024R9B3
Position
1q32.1
AA seq 419 aa AA seqDB search
MRNIFKRNQEPIVAPATTTATMPIGPVDNSTESGGAGESQEDMFAKLKEKLFNEINKIPL
PPWALIAIAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDA
ETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVK
VFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGE
VKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKM
DVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVL
DYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaggaacattttcaagaggaaccaggagcctattgtggctcctgccaccaccaccgcc
acgatgcccattggacccgtggacaactccactgagagtgggggtgctggggagagccag
gaggacatgtttgccaaactgaaggagaagttattcaatgagataaacaagattccctta
ccaccctgggcactgatcgccattgctgtggttgctgggctcctgcttctcacctgctgc
ttctgcatctgcaagaaatgctgctgcaagaagaagaagaacaagaaggagaagggcaaa
ggcatgaagaatgccatgaacatgaaggacatgaaagggggtcaggatgacgacgacgca
gagacaggcctgactgagggggaaggtgaaggggaggaggagaaagagccagagaacctg
ggcaaactgcagttttccctggactatgattttcaggctaatcagcttactgtgggcgtt
ctgcaggctgctgaactgcctgccctggacatgggaggcacctcagacccttatgtcaag
gtcttcctccttcctgacaagaagaagaaatatgagaccaaagtccatcggaagacactg
aaccctgccttcaatgaaaccttcaccttcaaggtgccataccaggagcttgggggcaaa
actctggtgatggccatctatgactttgaccgcttctccaaacatgacatcattggagag
gtaaaggtgcctatgaacacagtggacctcggccagcccattgaggagtggagagacctg
caaggcggggaaaaggaggagccggagaagctgggcgacatctgcacctccctgcgctat
gtgcccacggccgggaagctcactgtctgcatcctggaggctaagaacctcaagaagatg
gacgtgggcggcctttcagacccgtacgtgaagatccacctgatgcagaatggcaagagg
ctcaagaagaagaagacaaccgtgaagaagaagaccctgaacccatacttcaacgagtcc
ttcagctttgagatccccttcgagcagattcagaaagtccaggtagtggtcaccgtgctg
gactatgacaagctgggcaagaacgaagccataggcaagatcttcgtgggcagcaatgcc
acgggcacagagctgcggcactggtccgacatgctggccaacccccggaggcccatcgcc
cagtggcactcgctcaagcctgaggaggaggtggatgcactcctgggcaagaacaagtag

DBGET integrated database retrieval system