KEGG   Homo sapiens (human): 127933Help
Entry
127933            CDS       T01001                                 

Gene name
UHMK1, KIS, KIST, P-CIP2
Definition
(RefSeq) U2AF homology motif kinase 1
  KO
K08877  serine/threonine-protein kinase Kist [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    127933 (UHMK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     127933 (UHMK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  Other
   127933 (UHMK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RRM_1 Kinase-like Kdo APH RIO1 Choline_kinase
Motif
Other DBs
NCBI-GeneID: 127933
NCBI-ProteinID: NP_787062
OMIM: 608849
HGNC: 19683
Ensembl: ENSG00000152332
Vega: OTTHUMG00000031373
Pharos: Q8TAS1(Tbio)
UniProt: Q8TAS1
Position
1q23.3
AA seq 419 aa AA seqDB search
MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPG
TTGAAASAAEYGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVPSRCLLLELLDVSVSE
LLLYSSHQGCSMWMIQHCARDVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGL
SFKEGNQDVKYIQTDGYRAPEAELQNCLAQAGLQSDTECTSAVDLWSLGIILLEMFSGMK
LKHTVRSQEWKANSSAIIDHIFASKAVVNAAIPAYHLRDLIKSMLHDDPSRRIPAEMALC
SPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDDYLENEEEYEDVVEDVKEECQKYGPVVSL
LVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcgggatccggctgcgcctggggcgcggagccgccgcgttttctggaggccttcggg
cggctgtggcaggtacagagccgtctgggtagcggctcctccgcctcggtgtatcgggtt
cgctgctgcggcaaccctggctcgccccccggcgccctcaagcagttcttgccgccagga
accaccggggctgcggcctctgccgccgagtatggtttccgcaaagagagggcggcgctg
gaacagttgcagggtcacagaaacatcgtgactttgtatggagtgtttacaatccacttt
tctccaaatgtgccatcacgctgtctgttgcttgaactcctggatgtcagtgtttcggaa
ttgctcttatattccagtcaccagggttgttccatgtggatgatacagcattgtgcccga
gatgttttggaggcccttgcttttcttcatcatgagggctatgtccatgcggacctcaaa
ccacgtaacatattgtggagtgcagagaatgaatgttttaaactcattgactttggactt
agcttcaaagaaggcaatcaggatgtaaagtatattcagacagacgggtatcgggctcca
gaagcagaattgcaaaattgcttggcccaggctggcctgcagagtgatacagaatgtacc
tcagctgttgatctgtggagcctaggaatcattttactggaaatgttctcaggaatgaaa
ctgaaacatacagtcagatctcaggaatggaaggcaaacagttctgctattattgatcac
atatttgccagtaaagcagtggtgaatgccgcaattccagcctatcacctaagagacctt
atcaaaagcatgcttcatgatgatccaagcagaagaattcctgctgaaatggcattgtgc
agcccattctttagcattccttttgcccctcatattgaagatctggtcatgcttcccact
ccagtgctaagactgctgaatgtgctggatgatgattatcttgagaatgaagaggaatat
gaagatgttgtagaagatgtaaaagaggagtgtcaaaaatatggaccagtggtatctcta
cttgttccaaaggaaaatcctggcagaggacaagtctttgttgagtatgcaaatgctggt
gattccaaagctgcgcagaaattactgactggaaggatgtttgatgggaagtttgttgtg
gctacattctacccgctgagtgcctacaagaggggatatctgtatcaaaccttgctttaa

DBGET integrated database retrieval system