KEGG   Homo sapiens (human): 128Help
Entry
128               CDS       T01001                                 

Gene name
ADH5, ADH-3, ADHX, FALDH, FDH, GSH-FDH, GSNOR, HEL-S-60p
Definition
(RefSeq) alcohol dehydrogenase 5 (class III), chi polypeptide
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00071  Fatty acid degradation
hsa00350  Tyrosine metabolism
hsa00830  Retinol metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    128 (ADH5)
  Lipid metabolism
   00071 Fatty acid degradation
    128 (ADH5)
  Amino acid metabolism
   00350 Tyrosine metabolism
    128 (ADH5)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    128 (ADH5)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    128 (ADH5)
   00982 Drug metabolism - cytochrome P450
    128 (ADH5)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    128 (ADH5)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     128 (ADH5)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     128 (ADH5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 128
NCBI-ProteinID: NP_000662
OMIM: 103710
HGNC: 253
Ensembl: ENSG00000197894
Vega: OTTHUMG00000161230
Pharos: P11766(Tbio)
UniProt: P11766 Q6IRT1
Structure
PDB: 

Position
4q23
AA seq 374 aa AA seqDB search
MANEVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGC
FPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGK
GLMPDGTSRFTCKGKTILHYMGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGY
GAAVNTAKLEPGSVCAVFGLGGVGLAVIMGCKVAGASRIIGVDINKDKFARAKEFGATEC
INPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEE
IATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFE
LMHSGKSIRTVVKI
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgaggttatcaagtgcaaggctgcagttgcttgggaggctggaaagcctctc
tccatagaggagatagaggtggcacccccaaaggctcatgaagttcgaatcaagatcatt
gccactgcggtttgccacaccgatgcctataccctgagtggagctgatcctgagggttgt
tttccagtgatcttgggacatgaaggtgctggaattgtggaaagtgttggtgagggagtt
actaagctgaaggcgggtgacactgtcatcccactttacatcccacagtgtggagaatgc
aaattttgtctaaatcctaaaactaacctttgccagaagataagagtcactcaagggaaa
ggattaatgccagatggtaccagcagatttacttgcaaaggaaagacaattttgcattac
atgggaaccagcacattttctgaatacacagttgtggctgatatctctgttgctaaaata
gatcctttagcacctttggataaagtctgccttctaggttgtggcatttcaaccggttat
ggtgctgctgtgaacactgccaagttggagcctggctctgtttgtgccgtctttggtctg
ggaggagtcggattggcagttatcatgggctgtaaagtggctggtgcttcccggatcatt
ggtgtggacatcaataaagataaatttgcaagggccaaagagtttggagccactgaatgt
attaaccctcaggattttagtaaacccatccaggaagtgctcattgagatgaccgatgga
ggagtggactattcctttgaatgtattggtaatgtgaaggtcatgagagcagcacttgag
gcatgtcacaagggctggggcgtcagcgtcgtggttggagtagctgcttcaggtgaagaa
attgccactcgtccattccagctggtaacaggtcgcacatggaaaggcactgcctttgga
ggatggaagagtgtagaaagtgtcccaaagttggtgtctgaatatatgtccaaaaagata
aaagttgatgaatttgtgactcacaatctgtcttttgatgaaatcaacaaagcctttgaa
ctgatgcattctggaaagagcattcgaactgttgtaaagatttaa

DBGET integrated database retrieval system