KEGG   Homo sapiens (human): 128178Help
Entry
128178            CDS       T01001                                 

Gene name
EDARADD, ECTD11A, ECTD11B, ED3, EDA3
Definition
(RefSeq) EDAR associated death domain
Organism
hsa  Homo sapiens (human)
Disease
H00651  Hypohidrotic ectodermal dysplasia
SSDB OrthologParalogGFIT
Motif
Pfam: Death
Motif
Other DBs
NCBI-GeneID: 128178
NCBI-ProteinID: NP_665860
OMIM: 606603
HGNC: 14341
Ensembl: ENSG00000186197
Vega: OTTHUMG00000039954
Pharos: Q8WWZ3(Tbio)
UniProt: Q8WWZ3
Position
1q42.3-q43
AA seq 215 aa AA seqDB search
MGLRTTKQMGRGTKAPGHQEDHMVKEPVEDTDPSTLSFNMSDKYPIQDTELPKAEECDTI
TLNCPRNSDMKNQGEENGFPDSTGDPLPEISKDNSCKENCTCSSCLLRAPTISDLLNDQD
LLDVIRIKLDPCHPTVKNWRNFASKWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQLM
ELCRLYHRADVEKVLRRWVDEEWPKRERGDPSRHF
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgggcctcaggacgactaaacagatggggagaggcactaaagctcctggtcaccaagag
gatcatatggtaaaggaaccagtggaagacacagaccctagcactttatcctttaatatg
tcagacaaatatcccattcaagatacggaactccctaaagctgaagaatgtgatacaatt
actttgaactgcccacgaaattcagatatgaaaaatcagggagaagaaaatggctttcca
gatagcactggagatcctcttccagagatcagcaaggacaactcctgcaaagaaaactgt
acttgttcctcctgcttgctccgggcccccaccataagtgacttgctcaatgatcaggac
ttactagacgtgatcaggataaagctggatccgtgtcacccaacggtgaaaaactggagg
aattttgcaagcaaatgggggatgtcctatgacgaattgtgcttcctggagcagaggcca
cagagccccaccttggagttcttgctccggaacagtcagaggacggtgggccagctgatg
gagctctgcaggctctaccacagggccgacgtggagaaggttctgcgcaggtgggtggac
gaggagtggcccaagcgggagcgtggagacccctccaggcacttctag

DBGET integrated database retrieval system