KEGG   Homo sapiens (human): 128240
Entry
128240            CDS       T01001                                 

Gene name
NAXE, AIBP, APOA1BP, PEBEL, YJEFN1
Definition
(RefSeq) NAD(P)HX epimerase
  KO
K17759  NAD(P)H-hydrate epimerase [EC:5.1.99.6]
Organism
hsa  Homo sapiens (human)
Disease
H02262  PEBEL
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    128240 (NAXE)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.6  NAD(P)H-hydrate epimerase
     128240 (NAXE)
SSDB
Motif
Pfam: YjeF_N
Other DBs
NCBI-GeneID: 128240
NCBI-ProteinID: NP_658985
OMIM: 608862
HGNC: 18453
Ensembl: ENSG00000163382
Vega: OTTHUMG00000033206
Pharos: Q8NCW5(Tbio)
UniProt: Q8NCW5
Position
1q22
AA seq 288 aa
MSRLRALLGLGLLVAGSRVPRIKSQTIACRSGPTWWGPQRLNSGGRWDSEVMASTVVKYL
SQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVLVICGPGNN
GGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPAEPMTIDELY
ELVVDAIFGFSFKGDVREPFHSILSVLKGLTVPIASIDIPSGWDVEKGNAGGIQPDLLIS
LTAPKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPYPDTECVYRLQ
NT seq 867 nt   +upstreamnt  +downstreamnt
atgtccaggctgcgggcgctgctgggcctcgggctgctggttgcgggctcgcgcgtgccg
cggatcaaaagccagaccatcgcctgtcgctcgggacccacctggtggggaccgcagcgg
ctgaactcgggtggccgctgggactcagaggtcatggcgagcacggtggtgaagtacctg
agccaggaggaggcccaggccgtggaccaggagctatttaacgaataccagttcagcgtg
gaccaacttatggaactggccgggctgagctgtgctacagccatcgccaaggcatatccc
cccacgtccatgtccaggagcccccctactgtcctggtcatctgtggcccggggaataat
ggaggagatggtctggtctgtgctcgacacctcaaactctttggctacgagccaaccatc
tattaccccaaaaggcctaacaagcccctcttcactgcattggtgacccagtgtcagaaa
atggacatccctttccttggggaaatgcccgcagagcccatgacgattgatgaactgtat
gagctggtggtggatgccatctttggcttcagcttcaagggcgatgttcgggaaccgttc
cacagcatcctgagtgtcctgaagggactcactgtgcccattgccagcatcgacattccc
tcaggatgggacgtggagaagggaaatgctggagggatccagccagacttgctcatatcc
ctcacagcccccaaaaaatctgcaacccagtttaccggtcgctaccattacctggggggt
cgttttgtgccacctgctctggagaagaagtaccagctgaacctgccaccctaccctgac
accgagtgtgtctatcgtctgcagtga

DBGET integrated database retrieval system