KEGG   Homo sapiens (human): 128312
Entry
128312            CDS       T01001                                 

Gene name
H2BU1, H2Bb, HIST3H2BB
Definition
(RefSeq) H2B.U histone 1
  KO
K11252  histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    128312 (H2BU1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    128312 (H2BU1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    128312 (H2BU1)
  09165 Substance dependence
   05034 Alcoholism
    128312 (H2BU1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    128312 (H2BU1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    128312 (H2BU1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    128312 (H2BU1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   128312 (H2BU1)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Other DBs
NCBI-GeneID: 128312
NCBI-ProteinID: NP_778225
OMIM: 615046
HGNC: 20514
Ensembl: ENSG00000196890
Vega: OTTHUMG00000040045
Pharos: Q8N257(Tbio)
UniProt: Q8N257
Position
1q42.13
AA seq 126 aa
MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgccagacccgtccaaatcggctcctgcgcccaagaagggttctaaaaaggctgtcacc
aaggcacagaagaaggacggcaagaagcgcaagcgcggccgcaaggagagctattctatc
tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaatgacatcttcgagcgcatcgccagcgaggcctcccgc
ctggcacactacaacaagcgctccaccatcacgtcccgcgaagtgcagacggccgttcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggctgtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system