KEGG   Homo sapiens (human): 128674Help
Entry
128674            CDS       T01001                                 

Gene name
PROKR2, GPR73L1, GPR73b, GPRg2, HH3, KAL3, PKR2, dJ680N4.3
Definition
(RefSeq) prokineticin receptor 2
  KO
K08380  prokineticin receptor 2
Organism
hsa  Homo sapiens (human)
Network
  Element
N00879  PROK-PRKR-Gi-ERK signaling pathway
N00880  Mutation-inactivated PROK2 to PROK-PRKR-Gi-ERK signaling pathway
Disease
H00255  Hypogonadotropic hypogonadism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    128674 (PROKR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Prokineticin
    128674 (PROKR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 128674
NCBI-ProteinID: NP_658986
OMIM: 607123
HGNC: 15836
Ensembl: ENSG00000101292
Vega: OTTHUMG00000031800
Pharos: Q8NFJ6(Tbio)
UniProt: Q8NFJ6 A8K1T0
Position
20p12.3
AA seq 384 aa AA seqDB search
MAAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTFFAAKIVIGIAL
AGIMLVCGIGNFVFIAALTRYKKLRNLTNLLIANLAISDFLVAIICCPFEMDYYVVRQLS
WEHGHVLCASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLKPRMNYQTASFLIALVWMV
SILIAIPSAYFATETVLFIVKSQEKIFCGQIWPVDQQLYYKSYFLFIFGVEFVGPVVTMT
LCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIVRDF
FPTVFVKEKHYLTAFYVVECIAMSNSMINTVCFVTVKNNTMKYFKKMMLLHWRPSQRGSK
SSADLDLRTNGVPTTEEVDCIRLK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccagaatggaaacaccagtttcacacccaactttaatccaccccaagaccat
gcctcctccctctcctttaacttcagttatggtgattatgacctccctatggatgaggat
gaggacatgaccaagacccggaccttcttcgcagccaagatcgtcattggcattgcactg
gcaggcatcatgctggtctgcggcatcggtaactttgtctttatcgctgccctcacccgc
tataagaagttgcgcaacctcaccaatctgctcattgccaacctggccatctccgacttc
ctggtggccatcatctgctgccccttcgagatggactactacgtggtacggcagctctcc
tgggagcatggccacgtgctctgtgcctccgtcaactacctgcgcaccgtctccctctac
gtctccaccaatgccttgctggccattgccattgacagatatctcgccatcgttcacccc
ttgaaaccacggatgaattatcaaacggcctccttcctgatcgccttggtctggatggtg
tccattctcattgccatcccatcggcttactttgcaacagaaacggtcctctttattgtc
aagagccaggagaagatcttctgtggccagatctggcctgtggatcagcagctctactac
aagtcctacttcctcttcatctttggtgtcgagttcgtgggccctgtggtcaccatgacc
ctgtgctatgccaggatctcccgggagctctggttcaaggcagtccctgggttccagacg
gagcagattcgcaagcggctgcgctgccgcaggaagacggtcctggtgctcatgtgcatt
ctcacggcctatgtgctgtgctgggcacccttctacggtttcaccatcgttcgtgacttc
ttccccactgtgttcgtgaaggaaaagcactacctcactgccttctacgtggtcgagtgc
atcgccatgagcaacagcatgatcaacaccgtgtgcttcgtgacggtcaagaacaacacc
atgaagtacttcaagaagatgatgctgctgcactggcgtccctcccagcgggggagcaag
tccagtgctgaccttgacctcagaaccaacggggtgcccaccacagaagaggtggactgt
atcaggctgaagtga

DBGET integrated database retrieval system