KEGG   Homo sapiens (human): 128710Help
Entry
128710            CDS       T01001                                 

Gene name
SLX4IP, C20orf94, bA204H22.1, bA254M13.1, dJ1099D15.3
Definition
(RefSeq) SLX4 interacting protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: UPF0492
Motif
Other DBs
NCBI-GeneID: 128710
NCBI-ProteinID: NP_001009608
OMIM: 615958
HGNC: 16225
Ensembl: ENSG00000149346
Vega: OTTHUMG00000031873
Pharos: Q5VYV7(Tdark)
UniProt: Q5VYV7
Position
20p12.2
AA seq 408 aa AA seqDB search
MASKKFAVKCGNFAVLVDLHILPQGSNKDTSWFSEQKKEEVCLLLKETIDSRVQEYLEVR
KQHRPSNAEFTRSNPLSLKGYGFQITAYFLKRGIRLRCIRSTQNAELCVFPDRFVVCVSQ
LAFSRDLLASQNEDLTERVLHGVSDYFAECAESSLPPSAKLRRNALKEIVKRTETKSSVT
SKSQTRRDTVETSSDSVIAEIARRRNDGQASSSPPSESMGQAKDSIKAAESHWGLPVQKL
EKVNQTQPEDTSGQQKPHPGERLKTGLLSRSPVCSCESASPCPKQSPRVAKTQQKRRNCS
SAEDFDHHGRVSLGSDRLVPREIIVEKSKAVRVLPASELSDPGLLLKQDLAKTTSKEELH
VLESLSSRHLMKNNPGQAQQTGLATNTERLSTIQNSPTKKRKKYERGH
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggcatctaagaaatttgctgttaaatgtgggaattttgctgtcctcgtggatcttcat
atcttgccacaaggttcaaacaaagatacaagctggttttctgaacagaagaaagaggaa
gtctgtttactgttaaaagaaaccattgattcaagagttcaggagtacttggaagttcgc
aaacagcacaggccatcaaatgcagaattcacaagatccaatcccttgtccttaaaaggt
tatggctttcaaatcacagcctatttcctcaagagagggatacgccttcgctgcatcagg
agcacacagaatgctgaactctgtgtattccctgacagatttgtggtttgtgtcagtcag
cttgcattcagtcgtgatcttttagcaagtcagaatgaagatttgacagaaagagttctc
catggagtgtctgattactttgctgagtgtgcagagagttcacttcctcccagtgcaaag
ctccggagaaatgctctgaaagaaattgtgaaaagaactgaaacaaaaagcagtgtcacg
agcaaatcgcagaccagaagagacactgtggaaacatctagtgactcagtgattgcagag
atagcaaggaggaggaatgatggtcaggcttcctccagtcccccatcagaatccatggga
caagcaaaggattccataaaggcagctgagagccactgggggcttcctgttcaaaagctg
gaaaaagttaatcagacccagccagaagacactagtggccagcaaaaacctcatcctggg
gagcggttaaagacagggcttctaagcaggagccccgtctgtagctgtgagtcagcatca
ccatgtccaaaacaaagtccacgagtggccaaaacccaacagaaacgcaggaactgcagc
tctgcggaagacttcgaccaccacgggagagtttctcttggaagtgatcgattagtcccg
agagaaataatagtggaaaaaagcaaagctgtcagggttttgccagcttcagagttgtca
gatccagggttacttttgaaacaagatttggcaaaaaccacgtctaaggaagagttgcat
gttttggaaagtctctcctccagacatcttatgaaaaataacccagggcaggcacagcaa
accggcttagccacaaacactgaaagattatctacaattcagaacagcccaaccaagaaa
agaaagaaatacgaaagaggccattaa

DBGET integrated database retrieval system