KEGG   Homo sapiens (human): 128821
Entry
128821            CDS       T01001                                 
Symbol
CST9L, CTES7B, bA218C14.1
Name
(RefSeq) cystatin 9 like
  KO
K13905  cystatin-9
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    128821 (CST9L)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I25: cystatin family
   128821 (CST9L)
SSDB
Motif
Pfam: Cystatin Cathelicidins
Other DBs
NCBI-GeneID: 128821
NCBI-ProteinID: NP_542177
OMIM: 616536
HGNC: 16233
Ensembl: ENSG00000101435
Pharos: Q9H4G1(Tdark)
UniProt: Q9H4G1 A0A140VJH1
Position
20:complement(23564732..23568484)
AA seq 147 aa
MLGLPWKGGLSWALLLLLLGSQILLIYAWHFHEQRDCDEHNVMARYLPATVEFAVHTFNQ
QSKDYYAYRLGHILNSWKEQVESKTVFSMELLLGRTRCGKFEDDIDNCHFQESTELNNTF
TCFFTISTRPWMTQFSLLNKTCLEGFH
NT seq 444 nt   +upstreamnt  +downstreamnt
atgctgggcctgccgtggaagggaggtctgtcctgggcgctgctgctgcttctcttaggc
tcccagatcctgctgatctatgcctggcatttccacgagcaaagggactgtgatgaacac
aatgtcatggctcgttacctccctgccacagtggagtttgctgtccacacattcaaccaa
cagagcaaggactactatgcctacagactggggcacatcttgaattcctggaaggagcag
gtggagtccaagactgtattctcaatggagctactgctggggagaactaggtgtgggaaa
tttgaagacgacattgacaactgccatttccaagaaagcacagagctgaacaatactttc
acctgcttcttcaccatcagcaccaggccctggatgactcagttcagcctcctgaacaag
acctgcttggagggattccactga

DBGET integrated database retrieval system