KEGG   Homo sapiens (human): 1290Help
Entry
1290              CDS       T01001                                 

Gene name
COL5A2, EDSC, EDSCL2
Definition
(RefSeq) collagen type V alpha 2 chain
  KO
K19721  collagen, type V/XI/XXIV/XXVII, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Disease
H00802  Ehlers-Danlos syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    1290 (COL5A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1290 (COL5A2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   1290 (COL5A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen COLFI VWC TILa Amnionless
Motif
Other DBs
NCBI-GeneID: 1290
NCBI-ProteinID: NP_000384
OMIM: 120190
HGNC: 2210
Ensembl: ENSG00000204262
Vega: OTTHUMG00000149842
Pharos: P05997(Tbio)
UniProt: P05997
Position
2q32.2
AA seq 1499 aa AA seqDB search
MMANWAEARPLLILIVLLGQFVSIKAQEEDEDEGYGEEIACTQNGQMYLNRDIWKPAPCQ
ICVCDNGAILCDKIECQDVLDCADPVTPPGECCPVCSQTPGGGNTNFGRGRKGQKGEPGL
VPVVTGIRGRPGPAGPPGSQGPRGERGPKGRPGPRGPQGIDGEPGVPGQPGAPGPPGHPS
HPGPDGLSRPFSAQMAGLDEKSGLGSQVGLMPGSVGPVGPRGPQGLQGQQGGAGPTGPPG
EPGDPGPMGPIGSRGPEGPPGKPGEDGEPGRNGNPGEVGFAGSPGARGFPGAPGLPGLKG
HRGHKGLEGPKGEVGAPGSKGEAGPTGPMGAMGPLGPRGMPGERGRLGPQGAPGQRGAHG
MPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPVGSPGLPG
AIGTDGTPGAKGPTGSPGTSGPPGSAGPPGSPGPQGSTGPQGIRGQPGDPGVPGFKGEAG
PKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPVGERGAPGNRGFPGSDGLPGPKG
AQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPG
PPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPG
LAGERGEQGPPGPTGFQGLPGPPGPPGEGGKPGDQGVPGDPGAVGPLGPRGERGNPGERG
EPGITGLPGEKGMAGGHGPDGPKGSPGPSGTPGDTGPPGLQGMPGERGIAGTPGPKGDRG
GIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENG
PTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPNGVPGLKGGRG
TQGPPGATGFPGSAGRVGPPGPAGAPGPAGPLGEPGKEGPPGLRGDPGSHGRVGDRGPAG
PPGGPGDKGDPGEDGQPGPDGPPGPAGTTGQRGIVGMPGQRGERGMPGLPGPAGTPGKVG
PTGATGDKGPPGPVGPPGSNGPVGEPGPEGPAGNDGTPGRDGAVGERGDRGDPGPAGLPG
SQGAPGTPGPVGAPGDAGQRGDPGSRGPIGPPGRAGKRGLPGPQGPRGDKGDHGDRGDRG
QKGHRGFTGLQGLPGPPGPNGEQGSAGIPGPFGPRGPPGPVGPSGKEGNPGPLGPIGPPG
VRGSVGEAGPEGPPGEPGPPGPPGPPGHLTAALGDIMGHYDESMPDPLPEFTEDQAAPDD
KNKTDPGVHATLKSLSSQIETMRSPDGSKKHPARTCDDLKLCHSAKQSGEYWIDPNQGSV
EDAIKVYCNMETGETCISANPSSVPRKTWWASKSPDNKPVWYGLDMNRGSQFAYGDHQSP
NTAITQMTFLRLLSKEASQNITYICKNSVGYMDDQAKNLKKAVVLKGANDLDIKAEGNIR
FRYIVLQDTCSKRNGNVGKTVFEYRTQNVARLPIIDLAPVDVGGTDQEFGVEIGPVCFV
NT seq 4500 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaactgggcggaagcaagacctctcctcattcttattgttttattagggcaa
tttgtctcaataaaagcccaggaagaagacgaggatgaaggatatggtgaagaaatagcc
tgcactcagaatggccagatgtacttaaacagggacatttggaaacctgccccttgtcag
atctgtgtctgtgacaatggagccattctctgtgacaagatagaatgccaggatgtgctg
gactgtgccgaccctgtaacgccccctggggaatgctgtcctgtctgttcacaaacacct
ggaggtggcaataccaattttggtagaggaagaaagggacaaaagggagaaccaggatta
gtgcctgttgtaacaggcatacgtggtcgtccaggaccggcaggacctccaggatcacag
ggaccaagaggagagcgagggccaaaaggaagacctggccctcgtggacctcagggaatt
gatggagaaccaggtgttcctggtcaacctggtgctccaggacctcctggacatccgtcc
cacccaggacccgatggcttgagcaggccgttttcagctcaaatggctgggttggatgaa
aaatctggacttgggagtcaagtaggactaatgcctggctctgtgggtcctgttggccca
aggggaccacagggtttacaaggacagcaaggtggtgcaggacctacaggacctcctggt
gaacctggtgatcctggaccaatgggtccgattggttcacgtggaccagagggccctcct
ggtaaacctggggaagatggtgaacctggcagaaatggaaatcctggtgaagtgggattt
gcaggatctccgggagctcgtggatttcctggggctcctggtcttccaggtctgaagggt
caccgaggacacaaaggtcttgaaggccctaaaggtgaagttggagcacctggttccaag
ggtgaagctggccccactggtccaatgggtgccatgggtcctctgggtccgaggggaatg
ccaggagagagagggagacttgggccacagggtgctcctggacaacgaggtgcacatggt
atgcctggaaaacctggaccaatgggtcctcttgggataccaggctcttctggttttcca
ggaaatcctggaatgaagggagaagcaggtcctacaggggcgcgaggccctgaaggtcct
caggggcagagaggtgaaactgggcccccaggtccagttggctctccaggtcttcctggt
gcaataggaactgatggtactcctggtgccaaaggcccaacgggctctccaggtacctct
ggtcctcctggctcagcagggcctcctggatctccaggacctcagggtagcactggtcct
cagggaattcgaggccaaccgggtgatccaggagttccaggtttcaaaggagaagctggc
ccaaaaggggaaccagggccacatggtattcagggtccgataggcccacccggtgaagaa
ggcaaaagaggtcccagaggtgacccaggaacagttggtcctccagggccagtgggagaa
aggggtgctcctggcaatcgtggttttccaggctctgatggtttacctgggccaaagggt
gctcaaggagaacggggtcctgtaggttcttcaggacccaaaggaagccagggggatcca
ggacgtccaggggaacctgggcttccaggtgctcggggtttgacaggaaatcctggtgtt
caaggtcctgaaggaaaacttggacctttgggtgcgccaggggaagatggccgtccaggt
cctccaggctccataggaatcagagggcagcccgggagcatgggccttccaggccccaaa
ggtagcagtggtgaccctgggaaacctggagaagcaggaaatgctggagttcctgggcag
aggggagctcctggaaaagatggtgaagttggtccttctggtcctgtgggcccgccgggt
ctagctggtgaaagaggagaacaaggacctccaggccccacaggttttcaggggcttcct
ggtcctccagggcctcctggagaaggtggaaaaccaggtgatcaaggtgttcctggagat
cccggagcagttggcccgttaggacctagaggagaacgaggaaatcctggggaaagagga
gaacctgggataactggactccctggtgagaagggaatggctggaggacatggtcctgat
ggcccaaaaggcagtccaggtccatctgggacccctggagatacaggcccaccaggtctt
caaggtatgccgggagaaagaggaattgcaggaactcctggccccaagggtgacagaggt
ggcataggagaaaaaggtgctgaaggcacagctggaaatgatggtgcaagaggtcttcca
ggtcctttgggccctccaggtccggcaggtcctactggagaaaagggtgaacctggtcct
cgaggtttagttggccctcctggctcccggggcaatcctggttctcgaggtgaaaatggg
ccaactggagctgttggttttgccggaccccagggtcctgacggacagcctggagtaaaa
ggtgaacctggagagccaggacagaagggagatgctggttctcctggaccacaaggttta
gcaggatcccctggccctcatggtcctaatggtgttcctggactaaaaggtggtcgagga
acccaaggtccgcctggtgctacaggatttcctggttctgcgggcagagttggacctcca
ggccctgctggagctccaggacctgcgggacccctaggggaacccgggaaggagggacct
ccaggtcttcgtggggaccctggctctcatgggcgtgtgggagatcgaggaccagctggc
ccccctggtggcccaggagacaaaggggacccaggagaagatgggcaacctggtccagat
ggcccccctggtccagctggaacgaccgggcagagaggaattgttggcatgcctgggcaa
cgtggagagagaggcatgcccggcctaccaggcccagcgggaacaccaggaaaagtagga
ccaactggtgcaacaggagataaaggtccacctggacctgtggggcccccaggctccaat
ggtcctgtaggggaacctggaccagaaggtccagctggcaatgatggtaccccaggacgg
gatggtgctgttggagaacgtggtgatcgtggagaccctgggcctgcaggtctgccaggc
tctcagggtgcccctggaactcctggccctgtgggtgctccaggagatgcaggacaaaga
ggagatccgggttctcggggtcctataggaccacctggtcgagctgggaaacgtggatta
cctggaccccaaggacctcgtggtgacaaaggtgatcatggagaccgaggtgacagaggt
cagaagggccacagaggctttactggtcttcagggtcttcctggccctcctggtccaaat
ggtgaacaaggaagtgctggaatccctggaccatttggcccaagaggtcctccaggccca
gttggtccttcaggtaaagaaggaaaccctgggccacttgggccaattggacctccaggt
gtacgaggcagtgtaggagaagcaggacctgagggccctcctggtgagcctggcccacct
ggccctccgggtccccctggccaccttacagctgctcttggggatatcatggggcactat
gatgaaagcatgccagatccacttcctgagtttactgaagatcaggcggctcctgatgac
aaaaacaaaacggacccaggggttcatgctaccctgaagtcactcagtagtcagattgaa
accatgcgcagccccgatggctcgaaaaagcacccagcccgcacgtgtgatgacctaaag
ctttgccattccgcaaagcagagtggtgaatactggattgatcctaaccaaggatctgtt
gaagatgcaatcaaagtttactgcaacatggaaacaggagaaacatgtatttcagcaaac
ccatccagtgtaccacgtaaaacctggtgggccagtaaatctcctgacaataaacctgtt
tggtatggtcttgatatgaacagagggtctcagttcgcttatggagaccaccaatcacct
aatacagccattactcagatgacttttttgcgccttttatcaaaagaagcctcccagaac
atcacttacatctgtaaaaacagtgtaggatacatggacgatcaagctaagaacctcaaa
aaagctgtggttctcaaaggggcaaatgacttagatatcaaagcagagggaaatattaga
ttccggtatatcgttcttcaagacacttgctctaagcggaatggaaatgtgggcaagact
gtctttgaatatagaacacagaatgtggcacgcttgcccatcatagatcttgctcctgtg
gatgttggcggcacagaccaggaattcggcgttgaaattgggccagtttgttttgtgtaa

DBGET integrated database retrieval system