KEGG   Homo sapiens (human): 129025Help
Entry
129025            CDS       T01001                                 

Gene name
ZNF280A, 3'OY11.1, SUHW1, ZNF280, ZNF636
Definition
(RefSeq) zinc finger protein 280A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4195 zf-C2H2_6 zf-H2C2_2 zf-C2H2_4 zf-Di19 zf-C2H2_jaz
Motif
Other DBs
NCBI-GeneID: 129025
NCBI-ProteinID: NP_542778
HGNC: 18597
Ensembl: ENSG00000169548
Vega: OTTHUMG00000030545
Pharos: P59817(Tdark)
UniProt: P59817 A0A0G2JN84
Position
22q11.22
AA seq 542 aa AA seqDB search
MGDIFLCKKVESPKKNLRESKQREEDDEDPDLIYVGVEHVHRDAEVLFVGMISNSKPVVS
NILNRVTPGSNSRRKKGHFRQYPAHVSQPANHVTSMAKAIMPVSLSEGRSTDSPVTMKSS
SEPGYKMSSPQVVSPSSSDSLPPGTQCLVGAMVSGGGRNESSPDSKRLSTSDINSRDSKR
VKLRDGIPGVPSLAVVPSDMSSTISTNTPSQGICNSSNHVQNGVTFPWPDANGKAHFNLT
DPERASESALAMTDISSLASQNKTFDPKKENPIVLLSDFYYGQHKGDGQPEQKTHTTFKC
LSCVKVLKNIKFMNHMKHHLEFEKQRNDSWEDHTTCQHCHRQFPTPFQLQCHIDSVHIAM
GPSAVCKICELSFETDQVLLQHMKDHHKPGEMPYVCQVCHYRSSVFADVETHFRTCHENT
KNLLCLFCLKLFKTAIPYMNHCWRHSRRRVLQCSKCRLQFLTLKEEIEHKTKDHQTFKKP
EQLQGLPSETKVIIQTSVQPGSSGMASVIVSNTDPQSSPVKTKKKTAMNTRDSRLPCSKD
SS
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgggagatatctttttgtgtaagaaagtggaatcaccaaagaagaatttgagagaatcc
aaacaaagggaggaggatgatgaagatccagatctgatctatgttggggtggagcatgta
catagagatgctgaagttctctttgtcgggatgatttcaaattcaaaaccagtcgtttca
aacattttgaacagagtcaccccaggctcaaattcaagaagaaagaaaggccacttccgt
caatatcctgctcacgtgtcgcagcctgcaaatcatgtgacctctatggcaaaagccatc
atgccggtttctctgtctgaggggcgatcgacagatagtcctgtcactatgaagtcttca
tctgaacctggttataaaatgagctcaccacaagttgtttctcccagttcctcagactcg
ctccccccagggactcagtgtctagttggagctatggtctctggaggaggcagaaatgag
agttctcctgattcaaagcgactttccacttcagatataaacagcagagattccaaaagg
gttaaactcagggatggaatcccaggggtaccttctttagctgtggtcccttcagatatg
tcttctacaataagcacaaatacaccctcacaggggatctgcaactcatcaaaccatgtt
cagaatggagtaacatttccttggcctgatgctaatggaaaggcacatttcaatcttaca
gatccagagagagcaagtgagtctgccctggcaatgacagacatttcaagtctagcaagt
caaaacaagacctttgatcccaagaaagaaaatcccatcgtgttacttagcgacttttac
tatggacagcataaaggagatgggcagccggaacagaagactcacaccacctttaaatgc
ctcagctgcgtgaaagttctaaaaaatattaagtttatgaatcacatgaagcatcatttg
gaatttgagaagcagaggaacgacagctgggaagaccacaccacctgccagcactgccac
cggcagtttcccactcccttccagctacagtgtcacattgatagtgtacacatcgccatg
gggccctctgctgtctgtaaaatctgtgaattgtcatttgaaacagatcaggtcctctta
caacacatgaaggaccatcataagcctggcgaaatgccttatgtgtgccaggtttgccat
tacagatcgtcggtctttgctgatgtggaaacacattttagaacgtgccatgaaaacaca
aagaatttgctttgtctgttttgtctcaaacttttcaaaactgcaataccatacatgaat
cattgttggaggcacagcagaaggagggtccttcagtgttccaagtgccggctacagttt
ttgacgttgaaggaggaaatagagcacaaaaccaaggaccatcaaacatttaaaaagccg
gagcaactgcaagggttgcctagtgaaacaaaagttattattcaaacttcagttcagcca
ggatcaagtggtatggcttccgttattgttagcaacactgaccctcagtcttctcctgta
aaaactaaaaagaagacggctatgaacactagagattccagactcccttgcagcaaggat
tctagctga

DBGET integrated database retrieval system