KEGG   Homo sapiens (human): 129049
Entry
129049            CDS       T01001                                 

Gene name
SGSM1, RUTBC2
Definition
(RefSeq) small G protein signaling modulator 1
  KO
K21847  small G protein signaling modulator 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    129049 (SGSM1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    129049 (SGSM1)
SSDB
Motif
Pfam: RUN PH_RBD RabGAP-TBC
Other DBs
NCBI-GeneID: 129049
NCBI-ProteinID: NP_001035037
OMIM: 611417
HGNC: 29410
Ensembl: ENSG00000167037
Vega: OTTHUMG00000150837
Pharos: Q2NKQ1(Tbio)
UniProt: Q2NKQ1
Position
22q11.23
AA seq 1148 aa
MASAPAEAETRQRLLRTVKKEVKQIMEEAVTRKFVHEDSSHIISFCAAVEACVLHGLRRR
AAGFLRSNKIAALFMKVGKNFPPAEDLSRKVQDLEQLIESARNQIQGLQENVRKLPKLPN
LSPLAIKHLWIRTALFEKVLDKIVHYLVENSSKYYEKEALLMDPVDGPILASLLVGPCAL
EYTKMKTADHFWTDPSADELVQRHRIHSSHVRQDSPTKRPALCIQKRHSSGSMDDRPSLS
ARDYVESLHQNSRATLLYGKNNVLVQPRDDMEAVPGYLSLHQTADVMTLKWTPNQLMNGS
VGDLDYEKSVYWDYAMTIRLEEIVYLHCHQQVDSGGTVVLVSQDGIQRPPFRFPKGGHLL
QFLSCLENGLLPHGQLDPPLWSQRGKGKVFPKLRKRSPQGSAESTSSDKDDDEATDYVFR
IIYPGMQSEFVAPDFLGSTSSVSVGPAWMMVPAGRSMLVVARGSQWEPARWDTTLPTPSP
KEQPPMPQDLMDVSVSNLPSLWQPSPRKSSCSSCSQSGSADGSSTNGCNHERAPLKLLCD
NMKYQILSRAFYGWLAYCRHLSTVRTHLSALVNHMIVSPDLPCDAGQGLTARIWEQYLHD
STSYEEQELLRLIYYGGIQPEIRKAVWPFLLGHYQFGMTETERKEVDEQIHACYAQTMAE
WLGCEAIVRQRERESHAAALAKCSSGASLDSHLHRMLHRDSTISNESSQSCSSGRQNIRL
HSDSSSSTQVFESVDEVEQVEAEGRLEEKQPKIPNGNLVNGTCSPDSGHPSSHNFSSGLS
EHSEPSLSTEDSVLDAQRNTPTVLRPRDGSVDDRQSSEATTSQDEAPREELAVQDSLESD
LLANESMDEFMSITGSLDMALPEKDDVVMEGWRSSETEKHGQADSEDNLSEEPEMESLFP
ALASLAVTTSANEVSPVSSSGVTYSPELLDLYTVNLHRIEKDVQRCDRNYWYFTPANLEK
LRNIMCSYIWQHIEIGYVQGMCDLLAPLLVILDDEALAFSCFTELMKRMNQNFPHGGAMD
THFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRELVYDDVFLVWETIWAA
KHVSSAHYVLFIALALVEVYRDIILENNMDFTDIIKFFNEMAERHNTKQVLKLARDLVYK
VQTLIENK
NT seq 3447 nt   +upstreamnt  +downstreamnt
atggcctcggcccccgcggaggcggagacccgacagaggctgctacgcaccgtcaagaag
gaggtgaagcagatcatggaggaggctgtgacacgcaagtttgtccacgaagacagcagc
cacatcatctccttctgtgcggctgtggaggcctgcgttctgcacgggcttcggcggcgg
gcggctggcttcctacgcagcaataagattgcagccctctttatgaaagtgggcaagaac
ttcccgccggctgaggatctgagccgcaaggtgcaagacctggagcagctgatcgagagc
gcgagaaaccagattcaaggcctccaggagaatgtgcggaagctgccgaagctgcccaac
ttgtccccacttgccatcaagcatctgtggattcgcacagccttgtttgagaaggtcctg
gacaaaattgtgcattaccttgtggaaaacagcagtaaatactatgagaaggaagctctc
ctgatggaccctgtggacggccccatccttgcatctttgttggtggggccctgtgcccta
gagtacaccaagatgaagactgcagatcacttctggaccgatccctcggctgacgaactt
gtccagaggcaccgcatccacagctcccacgtgcggcaggactcgcccaccaagcgtcct
gccctctgtatccagaagaggcattccagtggcagcatggatgaccggccatccctctct
gcccgcgactacgtggagtccctgcatcagaactcccgtgccacccttctctatggcaaa
aacaacgttcttgttcagccgagggacgacatggaggctgtgccagggtacctgtccctg
caccagacggctgacgtcatgaccttgaagtggacacccaaccagctgatgaacgggtct
gtgggggacctggactatgagaagagcgtctactgggactatgccatgaccatccgcttg
gaggagattgtctacctgcactgccaccagcaagttgacagcggcgggacagtggtattg
gtcagccaggacgggatccagaggccgcccttccgcttccccaagggcgggcacctcctg
cagttcctctcgtgcctggagaatgggctgctcccacatgggcagttggacccgccactg
tggtcccagaggggtaagggcaaagtgtttcctaaactgcgcaagcgaagccctcagggt
tctgccgagtccacatcttcagacaaagatgatgatgaggccacggattatgtgttcagg
atcatctaccctggcatgcagtcggaattcgttgcccccgacttcttgggcagcacttcc
tccgtctctgtgggccctgcctggatgatggttcctgcaggccggtccatgctggtggtg
gccagagggagtcagtgggagccagccagatgggacactactctccccacgccaagcccg
aaggagcagccccccatgccccaggatctgatggacgtctctgtaagcaacctcccatcc
ctgtggcagcccagtccccggaagtcctcctgttcatcctgttcacagagtggctcggct
gatggtagctcgaccaatggctgcaaccatgagagggctcccctgaaacttctctgtgac
aatatgaagtaccagatcctctccagagccttctatggatggctggcctactgcagacac
ctgtccaccgtgagaacccacctatcagccctggtcaatcacatgatcgtgtctccagac
ttgccctgcgatgctggacagggactgacagccaggatctgggagcagtaccttcacgac
agcacaagttacgaggagcaggagctgctgcgcctcatctactacgggggcatccagcct
gagatccgcaaggccgtgtggcccttcctcctgggccactaccagttcgggatgacggaa
acagaaaggaaagaggtggacgagcagattcatgcctgctatgcacagaccatggctgag
tggctgggctgcgaggcgatcgtgcggcagagggagcgggagtcccatgcggccgccctg
gccaaatgctcatccggggccagcttggacagccacctgcaccggatgttgcacagggac
tcaaccatcagcaatgagtcctcccagagctgcagttcgggccgccagaacatccgcctg
cacagcgactccagcagcagcacacaggtgtttgagtctgtggatgaggtggagcaggtg
gaggctgaaggcagattggaggagaaacagcccaagatccccaatgggaacctagtgaac
ggcacttgttccccagactcgggtcatccttcctcccataacttctcctcgggcctctca
gagcactcagagcccagtctgagcacagaagacagtgtcttggacgcccagcggaacacc
cccacggtgctgcgacctagggatggcagcgtggatgacaggcagagcagcgaggccacc
acatctcaggatgaggctccccgggaggagctggccgtgcaggacagcctggagagtgac
ctcctggccaacgagagcatggacgagttcatgtccatcacgggcagcctggacatggcc
ctgcctgaaaaggacgatgttgtgatggagggctggaggagcagcgagacagagaaacat
ggccaggcggacagtgaggacaacctctcggaggagcctgagatggaaagtctcttccct
gccctggcttctctggctgtgactacttctgccaacgaggtgtcccctgtgtcttccagc
ggcgtcacctactctccagagctgctggatctgtacacggtgaacctgcaccgcatcgag
aaggatgtgcagaggtgcgaccgcaactactggtacttcacgcccgccaacttggagaag
ctgcgtaacatcatgtgcagctacatctggcagcacattgagatcggctatgtccagggc
atgtgtgatcttctggctccactgctggtcattctggatgatgaggcccttgccttcagc
tgcttcacggagctcatgaagaggatgaaccagaacttcccccacggaggcgccatggac
acgcactttgcaaacatgagatcgttgatccagatcctggactcagagctgtttgagctg
atgcatcagaacggggactatactcacttctacttctgctaccgctggttcctgctggat
ttcaagcgagaactcgtctatgatgacgtcttcttggtctgggagaccatctgggcagcc
aaacacgtctcctctgcgcactacgtcctgttcattgcgctggctctggtggaagtctac
cgtgacatcattttggagaacaacatggatttcacagacatcatcaaattctttaatgaa
atggctgagcgacacaacaccaagcaagtcctgaagctggcgcgggacctcgtgtacaag
gtgcagactctgattgagaacaagtga

DBGET integrated database retrieval system