KEGG   Homo sapiens (human): 1292Help
Entry
1292              CDS       T01001                                 

Gene name
COL6A2, BTHLM1, PP3610, UCMD1
Definition
(RefSeq) collagen type VI alpha 2 chain
  KO
K06238  collagen, type VI, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04974  Protein digestion and absorption
hsa05165  Human papillomavirus infection
Disease
H01338  Myosclerosis
H01340  Bethlem myopathy
H01341  Collagen VI myopathy
H01778  Ullrich disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    1292 (COL6A2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    1292 (COL6A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    1292 (COL6A2)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    1292 (COL6A2)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    1292 (COL6A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1292 (COL6A2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1292 (COL6A2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1292 (COL6A2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   1292 (COL6A2)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   1292 (COL6A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWA Collagen VWA_2 VWA_3 Ins134_P3_kin_N ParE-like_toxin
Motif
Other DBs
NCBI-GeneID: 1292
NCBI-ProteinID: NP_001840
OMIM: 120240
HGNC: 2212
Ensembl: ENSG00000142173
Vega: OTTHUMG00000090489
Pharos: P12110(Tbio)
UniProt: P12110 A0A384MDP3
Position
21q22.3
AA seq 1019 aa AA seqDB search
MLQGTCSVLLLWGILGAIQAQQQEVISPDTTERNNNCPEKTDCPIHVYFVLDTSESVTMQ
SPTDILLFHMKQFVPQFISQLQNEFYLDQVALSWRYGGLHFSDQVEVFSPPGSDRASFIK
NLQGISSFRRGTFTDCALANMTEQIRQDRSKGTVHFAVVITDGHVTGSPCGGIKLQAERA
REEGIRLFAVAPNQNLKEQGLRDIASTPHELYRNDYATMLPDSTEIDQDTINRIIKVMKH
EAYGECYKVSCLEIPGPSGPKGYRGQKGAKGNMGEPGEPGQKGRQGDPGIEGPIGFPGPK
GVPGFKGEKGEFGADGRKGAPGLAGKNGTDGQKGKLGRIGPPGCKGDPGNRGPDGYPGEA
GSPGERGDQGGKGDPGRPGRRGPPGEIGAKGSKGYQGNSGAPGSPGVKGAKGGPGPRGPK
GEPGRRGDPGTKGSPGSDGPKGEKGDPGPEGPRGLAGEVGNKGAKGDRGLPGPRGPQGAL
GEPGKQGSRGDPGDAGPRGDSGQPGPKGDPGRPGFSYPGPRGAPGEKGEPGPRGPEGGRG
DFGLKGEPGRKGEKGEPADPGPPGEPGPRGPRGVPGPEGEPGPPGDPGLTECDVMTYVRE
TCGCCDCEKRCGALDVVFVIDSSESIGYTNFTLEKNFVINVVNRLGAIAKDPKSETGTRV
GVVQYSHEGTFEAIQLDDERIDSLSSFKEAVKNLEWIAGGTWTPSALKFAYDRLIKESRR
QKTRVFAVVITDGRHDPRDDDLNLRALCDRDVTVTAIGIGDMFHEKHESENLYSIACDKP
QQVRNMTLFSDLVAEKFIDDMEDVLCPDPQIVCPDLPCQTELSVAQCTQRPVDIVFLLDG
SERLGEQNFHKARRFVEQVARRLTLARRDDDPLNARVALLQFGGPGEQQVAFPLSHNLTA
IHEALETTQYLNSFSHVGAGVVHAINAIVRSPRGGARRHAELSFVFLTDGVTGNDSLHES
AHSMRKQNVVPTVLALGSDVDMDVLTTLSLGDRAAVFHEKDYDSLAQPGFFDRFIRWIC
NT seq 3060 nt NT seq  +upstreamnt  +downstreamnt
atgctccagggcacctgctccgtgctcctgctctggggaatcctgggggccatccaggcc
cagcagcaggaggtcatctcgccggacactaccgagagaaacaacaactgcccagagaag
accgactgccccatccacgtgtacttcgtgctggacacctcggagagcgtcaccatgcag
tcccccacggacatcctgctcttccacatgaagcagttcgtgccgcagttcatcagccag
ctgcagaacgagttctacctggaccaggtggcgctgagctggcgctacggcggcctgcac
ttctctgaccaggtggaggtgttcagcccaccgggcagcgaccgggcctccttcatcaag
aacctgcagggcatcagctccttccgccgcggcaccttcaccgactgcgcgctggccaac
atgacggagcagatccggcaggaccgcagcaagggcaccgtccacttcgccgtggtcatc
accgacggccacgtcaccggcagcccctgcgggggcatcaagctgcaggccgagcgggcc
cgcgaggagggcatccggctcttcgccgtggcccccaaccagaacctgaaggagcagggc
ctgcgggacatcgccagcacgccgcacgagctctaccgcaacgactacgccaccatgctg
cccgactccaccgagatcgaccaggacaccatcaaccgcatcatcaaggtcatgaaacac
gaagcctacggagagtgctacaaggtgagctgcctggaaatccctgggccctctggcccc
aagggctaccgtggacagaagggtgccaagggcaacatgggtgagccgggagagcctggc
cagaagggaagacagggagacccgggcatcgaaggccccattggattcccaggacccaag
ggcgttcctggcttcaaaggagagaagggtgaatttggagccgacggtcgcaagggggcc
cctggcctggctggcaagaacgggaccgatggacagaagggcaagctggggcgcatcgga
cctcctggctgcaagggagaccctggaaaccggggccccgacggttacccgggggaagca
gggagtccaggggagcgaggagaccaaggcggcaagggggaccctggccgcccaggacgc
agagggcccccgggagaaatcggggccaagggaagcaaggggtatcaaggcaacagtgga
gccccaggaagtcctggtgtgaaaggagccaagggcgggcctgggccccgcggacccaaa
ggcgagccggggcgcaggggagaccccggcaccaagggcagcccaggcagcgatggcccc
aagggggagaagggggaccctggccctgaggggccccgcggcctggctggagaggttggc
aacaaaggagccaagggagaccgaggcttgcctggacccagaggcccccagggagctctt
ggggagcccggaaagcagggatctcggggagaccccggtgatgcaggaccccgtggagac
tcaggacagccaggccccaagggagaccccggcaggcctggattcagctacccaggaccc
cgaggagcacccggagaaaaaggcgagcccggcccacgcggccccgagggaggccgaggc
gactttggcttgaaaggagaacctgggaggaaaggagagaaaggagagcctgcggatcct
ggtccccctggtgagccaggccctcgggggccaagaggagtcccaggacccgagggtgag
cccggcccccctggagaccccggtctcacggagtgtgacgtcatgacctacgtgagggag
acctgcgggtgctgcgactgtgagaagcgctgtggcgccctggacgtggtcttcgtcatc
gacagctccgagagcattgggtacaccaacttcacactggagaagaacttcgtcatcaac
gtggtcaacaggctgggtgccatcgctaaggaccccaagtccgagacagggacgcgtgtg
ggcgtggtgcagtacagccacgagggcacctttgaggccatccagctggacgacgaacgt
atcgactccctgtcgagcttcaaggaggctgtcaagaacctcgagtggattgcgggcggc
acctggacaccctcagccctcaagtttgcctacgaccgcctcatcaaggagagccggcgc
cagaagacacgtgtgtttgcggtggtcatcacggacgggcgccacgaccctcgggacgat
gacctcaacttgcgggcgctgtgcgaccgcgacgtcacagtgacggccatcggcatcggg
gacatgttccacgagaagcacgagagtgaaaacctctactccatcgcctgcgacaagcca
cagcaggtgcgcaacatgacgctgttctccgacctggtcgctgagaagttcatcgatgac
atggaggacgtcctctgcccggaccctcagatcgtgtgcccagaccttccctgccaaaca
gagctgtccgtggcacagtgcacgcagcggcccgtggacatcgtcttcctgctggacggc
tccgagcggctgggtgagcagaacttccacaaggcccggcgcttcgtggagcaggtggcg
cggcggctgacgctggcccggagggacgacgaccctctcaacgcacgcgtggcgctgctg
cagtttggtggccccggcgagcagcaggtggccttcccgctgagccacaacctcacggcc
atccacgaggcgctggagaccacacaatacctgaactccttctcgcacgtgggcgcaggc
gtggtgcacgccatcaatgccatcgtgcgcagcccgcgtggcggggcccggaggcacgca
gagctgtccttcgtgttcctcacggacggcgtcacgggcaacgacagtctgcacgagtcg
gcgcactccatgcgcaagcagaacgtggtacccaccgtgctggccttgggcagcgacgtg
gacatggacgtgctcaccacgctcagcctgggtgaccgcgccgccgtgttccacgagaag
gactatgacagcctggcgcaacccggcttcttcgaccgcttcatccgctggatctgctag

DBGET integrated database retrieval system