KEGG   Homo sapiens (human): 129401Help
Entry
129401            CDS       T01001                                 

Gene name
NUP35, MP-44, MP44, NP44, NUP53
Definition
(RefSeq) nucleoporin 35
  KO
K14313  nuclear pore complex protein Nup53
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    129401 (NUP35)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    129401 (NUP35)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     129401 (NUP35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nup35_RRM Nup35_RRM_2
Motif
Other DBs
NCBI-GeneID: 129401
NCBI-ProteinID: NP_612142
OMIM: 608140
HGNC: 29797
Ensembl: ENSG00000163002
Vega: OTTHUMG00000132621
Pharos: Q8NFH5(Tbio)
UniProt: Q8NFH5
Structure
PDB: 

Position
2q32.1
AA seq 326 aa AA seqDB search
MAAFAVEPQGPALGSEPMMLGSPTSPKPGVNAQFLPGFLMGDLPAPVTPQPRSISGPSVG
VMEMRSPLLAGGSPPQPVVPAHKDKSGAPPVRSIYDDISSPGLGSTPLTSRRQPNISVMQ
SPLVGVTSTPGTGQSMFSPASIGQPRKTTLSPAQLDPFYTQGDSLTSEDHLDDSWVTVFG
FPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGV
KPCIDKSVMESSDRCALSSPSLAFTPPIKTLGTPTQPGSTPRISTMRPLATAYKASTSDY
QVISDRQTPKKDESLVSKAMEYMFGW
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctttgcagtggaacctcaggggcccgcgttaggatctgaaccaatgatgctg
ggttcacccacatctccaaagccaggagttaatgcccagttcttacctggatttttaatg
ggggatttgccagctccggtgactccacaacctcgatcaattagtggcccttcagtagga
gtaatggaaatgagatcacctttacttgcaggtgggtcaccaccacaaccagttgtacca
gctcataaagataaaagtggcgctccaccagttagaagtatatatgatgacatttctagc
ccaggacttggatcaacacctttaacttcaagaagacagccaaacatttcagtaatgcag
agtcctcttgttggagttacatctactcctggaacagggcaaagtatgtttagtccagca
agtatcggtcagccacgaaagacgacattatctcctgcccagttggatcctttttatact
caaggagattctttgacttcagaagatcacctcgatgactcttgggtgactgtatttggg
tttcctcaagcatctgcttcctacatattactacaatttgcacagtatgggaatatctta
aaacatgtgatgtctaatacaggaaattggatgcatattcgttatcaatctaaactgcag
gctcggaaagccttaagcaaagatgggaggatttttggagaatccatcatgattggtgta
aaaccatgtattgacaaaagtgttatggaaagcagtgacagatgtgctttatcatctcca
tctttagcctttacaccaccaatcaaaactctaggtacaccaacacaacctggaagtact
cctaggatttctaccatgagacctcttgctacagcatacaaagcctctactagtgattat
caggttatttctgacagacaaacgccaaaaaaagatgaaagtcttgtatccaaagcaatg
gagtacatgtttggctggtag

DBGET integrated database retrieval system