KEGG   Homo sapiens (human): 129401
Entry
129401            CDS       T01001                                 

Gene name
NUP35, MP-44, MP44, NP44, NUP53
Definition
(RefSeq) nucleoporin 35
  KO
K14313  nuclear pore complex protein Nup53
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa05014  Amyotrophic lateral sclerosis
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    129401 (NUP35)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    129401 (NUP35)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    129401 (NUP35)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     129401 (NUP35)
SSDB
Motif
Pfam: Nup35_RRM Nup35_RRM_2
Other DBs
NCBI-GeneID: 129401
NCBI-ProteinID: NP_612142
OMIM: 608140
HGNC: 29797
Ensembl: ENSG00000163002
Vega: OTTHUMG00000132621
Pharos: Q8NFH5(Tbio)
UniProt: Q8NFH5
Structure
PDB: 
4LIR

Position
2q32.1
AA seq 326 aa
MAAFAVEPQGPALGSEPMMLGSPTSPKPGVNAQFLPGFLMGDLPAPVTPQPRSISGPSVG
VMEMRSPLLAGGSPPQPVVPAHKDKSGAPPVRSIYDDISSPGLGSTPLTSRRQPNISVMQ
SPLVGVTSTPGTGQSMFSPASIGQPRKTTLSPAQLDPFYTQGDSLTSEDHLDDSWVTVFG
FPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGV
KPCIDKSVMESSDRCALSSPSLAFTPPIKTLGTPTQPGSTPRISTMRPLATAYKASTSDY
QVISDRQTPKKDESLVSKAMEYMFGW
NT seq 981 nt   +upstreamnt  +downstreamnt
atggcagcctttgcagtggaacctcaggggcccgcgttaggatctgaaccaatgatgctg
ggttcacccacatctccaaagccaggagttaatgcccagttcttacctggatttttaatg
ggggatttgccagctccggtgactccacaacctcgatcaattagtggcccttcagtagga
gtaatggaaatgagatcacctttacttgcaggtgggtcaccaccacaaccagttgtacca
gctcataaagataaaagtggcgctccaccagttagaagtatatatgatgacatttctagc
ccaggacttggatcaacacctttaacttcaagaagacagccaaacatttcagtaatgcag
agtcctcttgttggagttacatctactcctggaacagggcaaagtatgtttagtccagca
agtatcggtcagccacgaaagacgacattatctcctgcccagttggatcctttttatact
caaggagattctttgacttcagaagatcacctcgatgactcttgggtgactgtatttggg
tttcctcaagcatctgcttcctacatattactacaatttgcacagtatgggaatatctta
aaacatgtgatgtctaatacaggaaattggatgcatattcgttatcaatctaaactgcag
gctcggaaagccttaagcaaagatgggaggatttttggagaatccatcatgattggtgta
aaaccatgtattgacaaaagtgttatggaaagcagtgacagatgtgctttatcatctcca
tctttagcctttacaccaccaatcaaaactctaggtacaccaacacaacctggaagtact
cctaggatttctaccatgagacctcttgctacagcatacaaagcctctactagtgattat
caggttatttctgacagacaaacgccaaaaaaagatgaaagtcttgtatccaaagcaatg
gagtacatgtttggctggtag

DBGET integrated database retrieval system