KEGG   Homo sapiens (human): 1296
Entry
1296              CDS       T01001                                 

Gene name
COL8A2, FECD, FECD1, PPCD, PPCD2
Definition
(RefSeq) collagen type VIII alpha 2 chain
  KO
K23455  collagen, type VIII, alpha
Organism
hsa  Homo sapiens (human)
Disease
H00960  Fuchs corneal dystrophy
H00961  Posterior polymorphous corneal dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    1296 (COL8A2)
SSDB
Motif
Pfam: Collagen C1q BclA_C
Other DBs
NCBI-GeneID: 1296
NCBI-ProteinID: NP_005193
OMIM: 120252
HGNC: 2216
Ensembl: ENSG00000171812
Vega: OTTHUMG00000007665
Pharos: P25067(Tbio)
UniProt: P25067
Position
1p34.3
AA seq 703 aa
MLGTLTPLSSLLLLLLVLVLGCGPRASSGGGAGGAAGYAPVKYIQPMQKGPVGPPFREGK
GQYLEMPLPLLPMDLKGEPGPPGKPGPRGPPGPPGFPGKPGMGKPGLHGQPGPAGPPGFS
RMGKAGPPGLPGKVGPPGQPGLRGEPGIRGDQGLRGPPGPPGLPGPSGITIPGKPGAQGV
PGPPGFQGEPGPQGEPGPPGDRGLKGDNGVGQPGLPGAPGQGGAPGPPGLPGPAGLGKPG
LDGLPGAPGDKGESGPPGVPGPRGEPGAVGPKGPPGVDGVGVPGAAGLPGPQGPSGAKGE
PGTRGPPGLIGPTGYGMPGLPGPKGDRGPAGVPGLLGDRGEPGEDGEPGEQGPQGLGGPP
GLPGSAGLPGRRGPPGPKGEAGPGGPPGVPGIRGDQGPSGLAGKPGVPGERGLPGAHGPP
GPTGPKGEPGFTGRPGGPGVAGALGQKGDLGLPGQPGLRGPSGIPGLQGPAGPIGPQGLP
GLKGEPGLPGPPGEGRAGEPGTAGPTGPPGVPGSPGITGPPGPPGPPGPPGAPGAFDETG
IAGLHLPNGGVEGAVLGKGGKPQFGLGELSAHATPAFTAVLTSPFPASGMPVKFDRTLYN
GHSGYNPATGIFTCPVGGVYYFAYHVHVKGTNVWVALYKNNVPATYTYDEYKKGYLDQAS
GGAVLQLRPNDQVWVQMPSDQANGLYSTEYIHSSFSGFLLCPT
NT seq 2112 nt   +upstreamnt  +downstreamnt
atgctggggactctgacacccctgtcttcgctgctgctgctgctactggtgctggtgctg
gggtgtgggccgcgggcgtcctctggtggcggggccggtggggcggcgggctatgcccca
gtgaagtacatccagcccatgcagaaaggacctgtgggaccgcccttccgtgagggcaaa
ggccagtacctggaaatgcctctaccgctgctgccgatggacctgaagggagagcccggc
ccccctgggaagcccgggcctcggggtccccctggcccccctggcttcccaggaaaacca
ggcatgggaaagccaggactccatgggcagcctggccctgctgggccccctggcttctcc
cggatgggcaaggctggtcccccagggctccctggcaaggtcgggccaccagggcagccg
gggcttcggggggagccaggaatacgaggggaccagggcctccggggacccccaggaccc
cctggcctcccgggcccctcaggcattactatccctggaaaaccaggtgcccaaggggtg
ccagggcccccaggattccagggggaaccagggccccagggggagcctgggcccccaggt
gatcgaggcctcaagggggataatggagtgggccagcccgggctgcctggggccccaggg
caggggggtgcccccggcccccccggcctccctggtccagctggcttaggcaaacctggt
ttggatgggcttcctggggccccaggagacaagggtgagtctgggcctcctggagttcca
ggccccaggggggagccaggagctgtgggcccaaaaggacctcctggagtagacggtgtg
ggagtcccaggggcagcagggttgccaggaccacagggcccatcaggggccaaaggggag
ccagggacccggggcccccctgggctgataggccccactggctatgggatgccaggactg
ccaggccccaagggggacaggggcccagctggggtcccaggactcttgggggacaggggt
gagccaggggaggatggggagccaggggagcagggcccacagggtcttgggggtccccct
ggacttcctgggtctgcagggcttcctggcagacgtgggccccctgggcctaagggtgag
gcagggcctggaggacccccaggagtgcctggcattcgaggtgaccaggggcctagtggc
ctggctgggaaaccaggggtcccaggtgagaggggacttcctggggcccatggaccccct
ggaccaactgggcccaagggtgagccgggtttcacgggtcgccctggaggaccaggggtg
gcaggagccctggggcagaaaggtgacttggggctccctgggcagcctggcctgaggggt
ccctcaggaatcccaggactccagggtccagctggccctattgggccccaaggcctgccg
ggcctgaagggggaaccaggcctgccagggccccctggagaggggagagcaggggaacct
ggcacggctgggcccacggggcccccaggggtccctggctcccctggaatcacgggccct
ccggggcctcccgggcccccgggaccccctggtgcccctggggccttcgatgagactggc
atcgcaggcttgcacctgcccaacggcggtgtggagggtgccgtgctgggcaaggggggc
aagccacagtttgggctgggcgagctgtctgcccatgccacaccggccttcactgcggtg
ctcacctcgcccttccccgcctcgggcatgcccgtgaaatttgaccggactctctacaat
ggccacagcggctacaacccagccactggcatcttcacctgccctgtgggcggcgtctac
tactttgcttaccatgtgcacgtcaagggcaccaacgtgtgggtggccctgtacaagaac
aacgtgccggccacctatacctacgatgagtacaagaagggctacctggaccaggcatct
ggtggggccgtgctccagctgcggcccaacgaccaggtctgggtgcagatgccgtcggac
caggccaacggcctctactccacggagtacatccactcctccttttcaggattcttgctc
tgccccacataa

DBGET integrated database retrieval system