KEGG   Homo sapiens (human): 1296
Entry
1296              CDS       T01001                                 
Symbol
COL8A2, FECD, FECD1, PPCD, PPCD2
Name
(RefSeq) collagen type VIII alpha 2 chain
  KO
K23455  collagen type VIII alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Disease
H00960  Fuchs corneal dystrophy
H00961  Posterior polymorphous corneal dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    1296 (COL8A2)
SSDB
Motif
Pfam: Collagen C1q BclA_C
Other DBs
NCBI-GeneID: 1296
NCBI-ProteinID: NP_005193
OMIM: 120252
HGNC: 2216
Ensembl: ENSG00000171812
Pharos: P25067(Tbio)
UniProt: P25067
Position
1:complement(36095239..36125222)
AA seq 703 aa
MLGTLTPLSSLLLLLLVLVLGCGPRASSGGGAGGAAGYAPVKYIQPMQKGPVGPPFREGK
GQYLEMPLPLLPMDLKGEPGPPGKPGPRGPPGPPGFPGKPGMGKPGLHGQPGPAGPPGFS
RMGKAGPPGLPGKVGPPGQPGLRGEPGIRGDQGLRGPPGPPGLPGPSGITIPGKPGAQGV
PGPPGFQGEPGPQGEPGPPGDRGLKGDNGVGQPGLPGAPGQGGAPGPPGLPGPAGLGKPG
LDGLPGAPGDKGESGPPGVPGPRGEPGAVGPKGPPGVDGVGVPGAAGLPGPQGPSGAKGE
PGTRGPPGLIGPTGYGMPGLPGPKGDRGPAGVPGLLGDRGEPGEDGEPGEQGPQGLGGPP
GLPGSAGLPGRRGPPGPKGEAGPGGPPGVPGIRGDQGPSGLAGKPGVPGERGLPGAHGPP
GPTGPKGEPGFTGRPGGPGVAGALGQKGDLGLPGQPGLRGPSGIPGLQGPAGPIGPQGLP
GLKGEPGLPGPPGEGRAGEPGTAGPTGPPGVPGSPGITGPPGPPGPPGPPGAPGAFDETG
IAGLHLPNGGVEGAVLGKGGKPQFGLGELSAHATPAFTAVLTSPFPASGMPVKFDRTLYN
GHSGYNPATGIFTCPVGGVYYFAYHVHVKGTNVWVALYKNNVPATYTYDEYKKGYLDQAS
GGAVLQLRPNDQVWVQMPSDQANGLYSTEYIHSSFSGFLLCPT
NT seq 2112 nt   +upstreamnt  +downstreamnt
atgctggggactctgacacccctgtcttcgctgctgctgctgctactggtgctggtgctg
gggtgtgggccgcgggcgtcctctggtggcggggccggtggggcggcgggctatgcccca
gtgaagtacatccagcccatgcagaaaggacctgtgggaccgcccttccgtgagggcaaa
ggccagtacctggaaatgcctctaccgctgctgccgatggacctgaagggagagcccggc
ccccctgggaagcccgggcctcggggtccccctggcccccctggcttcccaggaaaacca
ggcatgggaaagccaggactccatgggcagcctggccctgctgggccccctggcttctcc
cggatgggcaaggctggtcccccagggctccctggcaaggtcgggccaccagggcagccg
gggcttcggggggagccaggaatacgaggggaccagggcctccggggacccccaggaccc
cctggcctcccgggcccctcaggcattactatccctggaaaaccaggtgcccaaggggtg
ccagggcccccaggattccagggggaaccagggccccagggggagcctgggcccccaggt
gatcgaggcctcaagggggataatggagtgggccagcccgggctgcctggggccccaggg
caggggggtgcccccggcccccccggcctccctggtccagctggcttaggcaaacctggt
ttggatgggcttcctggggccccaggagacaagggtgagtctgggcctcctggagttcca
ggccccaggggggagccaggagctgtgggcccaaaaggacctcctggagtagacggtgtg
ggagtcccaggggcagcagggttgccaggaccacagggcccatcaggggccaaaggggag
ccagggacccggggcccccctgggctgataggccccactggctatgggatgccaggactg
ccaggccccaagggggacaggggcccagctggggtcccaggactcttgggggacaggggt
gagccaggggaggatggggagccaggggagcagggcccacagggtcttgggggtccccct
ggacttcctgggtctgcagggcttcctggcagacgtgggccccctgggcctaagggtgag
gcagggcctggaggacccccaggagtgcctggcattcgaggtgaccaggggcctagtggc
ctggctgggaaaccaggggtcccaggtgagaggggacttcctggggcccatggaccccct
ggaccaactgggcccaagggtgagccgggtttcacgggtcgccctggaggaccaggggtg
gcaggagccctggggcagaaaggtgacttggggctccctgggcagcctggcctgaggggt
ccctcaggaatcccaggactccagggtccagctggccctattgggccccaaggcctgccg
ggcctgaagggggaaccaggcctgccagggccccctggagaggggagagcaggggaacct
ggcacggctgggcccacggggcccccaggggtccctggctcccctggaatcacgggccct
ccggggcctcccgggcccccgggaccccctggtgcccctggggccttcgatgagactggc
atcgcaggcttgcacctgcccaacggcggtgtggagggtgccgtgctgggcaaggggggc
aagccacagtttgggctgggcgagctgtctgcccatgccacaccggccttcactgcggtg
ctcacctcgcccttccccgcctcgggcatgcccgtgaaatttgaccggactctctacaat
ggccacagcggctacaacccagccactggcatcttcacctgccctgtgggcggcgtctac
tactttgcttaccatgtgcacgtcaagggcaccaacgtgtgggtggccctgtacaagaac
aacgtgccggccacctatacctacgatgagtacaagaagggctacctggaccaggcatct
ggtggggccgtgctccagctgcggcccaacgaccaggtctgggtgcagatgccgtcggac
caggccaacggcctctactccacggagtacatccactcctccttttcaggattcttgctc
tgccccacataa

DBGET integrated database retrieval system