KEGG   Homo sapiens (human): 129804
Entry
129804            CDS       T01001                                 

Gene name
FBLN7, TM14
Definition
(RefSeq) fibulin 7
  KO
K17342  fibulin 7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    129804 (FBLN7)
SSDB
Motif
Pfam: EGF_CA cEGF EGF Sushi hEGF FXa_inhibition EGF_3 EGF_2
Other DBs
NCBI-GeneID: 129804
NCBI-ProteinID: NP_694946
OMIM: 611551
HGNC: 26740
Ensembl: ENSG00000144152
Vega: OTTHUMG00000153267
Pharos: Q53RD9(Tbio)
UniProt: Q53RD9
Position
2q13-q14.1
AA seq 439 aa
MVPSSPRALFLLLLILACPEPRASQNCLSKQQLLSAIRQLQQLLKGQETRFAEGIRHMKS
RLAALQNSVGRVGPDALPVSCPALNTPADGRKFGSKYLVDHEVHFTCNPGFRLVGPSSVV
CLPNGTWTGEQPHCRGISECSSQPCQNGGTCVEGVNQYRCICPPGRTGNRCQHQAQTAAP
EGSVAGDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAGDSVCQDVNECELYGQEGRPRLC
MHACVNTPGSYRCTCPGGYRTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSFQCVSPE
CPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMATA
SAPGRAGPNSLRFGIVGGNSRGHFVMQRSDRQTGDLILVQNLEGPQTLEVDVDMSEYLDR
SFQANHVSKVTIFVSPYDF
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggtgcccagctctccgcgcgcgctcttccttctgctcctgatcctcgcctgccccgag
ccgcgggcttcccagaactgtctcagcaaacagcagctcctctcggccatccgccagctg
cagcagctgctgaagggccaggagacacgcttcgccgagggcatccgccacatgaagagc
cggctggccgcgctgcagaactctgtgggcagggtgggcccagatgcccttccagtttcc
tgcccggctctgaacacccccgcagacggcagaaagtttggaagcaagtacttagtggat
cacgaagtccattttacctgcaaccctgggttccggctggtcgggcccagcagcgtggtg
tgtcttcccaatggcacctggacaggggagcagccccactgtagaggtatcagtgaatgc
tccagccagccttgtcaaaatggtggtacatgtgtagaaggagtcaaccagtacagatgc
atttgtcctccaggaaggactgggaaccgctgtcagcatcaggcccagactgccgccccc
gagggcagcgtggccggcgactccgccttcagccgcgcgccgcgctgtgcgcaggtggag
cgggctcagcactgcagctgcgaggccggattccacctgagcggcgccgccggcgacagc
gtctgccaggacgtgaacgagtgtgagctctacgggcaggaggggcgcccccggctctgc
atgcacgcctgcgtgaacaccccgggctcttaccgttgcacctgccccggtggataccga
actctggctgacgggaagagctgtgaggatgtggatgaatgtgtgggcctgcagccggtg
tgcccccaggggaccacatgcatcaacaccggtggaagcttccagtgtgtcagccctgag
tgccccgagggcagcggcaatgtgagctacgtgaagacgtctccattccagtgtgagcgg
aacccctgccccatggacagcaggccctgccgccatctgcccaagaccatctccttccat
tacctctctctgccttccaacctgaagacgcccatcacgctcttccgcatggccacagcc
tctgcccccggccgagctgggcccaacagcctgcggtttgggatcgtgggtgggaacagc
cgcggccactttgtgatgcagcgttcagaccggcagactggggatctgatccttgtgcag
aacctggaggggcctcagacgctggaggtggacgtcgacatgtcggaatacctggaccgc
tccttccaggccaaccacgtgtccaaggtcaccatctttgtatccccctatgacttctga

DBGET integrated database retrieval system