KEGG   Homo sapiens (human): 129831
Entry
129831            CDS       T01001                                 
Symbol
RBM45, DRB1, RB-1
Name
(RefSeq) RNA binding motif protein 45
  KO
K25081  RNA-binding protein 45
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    129831 (RBM45)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Other domain-containing proteins
  RRM domain-containing proteins
   129831 (RBM45)
SSDB
Motif
Pfam: RRM_1 RRM_5 Nup35_RRM_2 RNA_bind RRM_3
Other DBs
NCBI-GeneID: 129831
NCBI-ProteinID: NP_694453
OMIM: 608888
HGNC: 24468
Ensembl: ENSG00000155636
Pharos: Q8IUH3(Tbio)
UniProt: Q8IUH3
Structure
Position
2:178112437..178139011
AA seq 474 aa
MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGDIQDIWVVRDK
HTKESKGIAFVKFARSSQACRAMEEMHGQCLGPNDTKPIKVFIAQSRSSGSHRDVEDEEL
TRIFVMIPKSYTEEDLREKFKVYGDIEYCSIIKNKVTGESKGLGYVRYLKPSQAAQAIEN
CDRSFRAILAEPKNKASESSEQDYYSNMRQEALGHEPRVNMFPFEQQSEFSSFDKNDSRG
QEAISKRLSVVSRVPFTEEQLFSIFDIVPGLEYCEVQRDPYSNYGHGVVQYFNVASAIYA
KYKLHGFQYPPGNRIGVSFIDDGSNATDLLRKMATQMVAAQLASMVWNNPSQQQFMQFGG
SSGSQLPQIQTDVVLPSCKKKAPAETPVKERLFIVFNPHPLPLDVLEDIFCRFGNLIEVY
LVSGKNVGYAKYADRISANDAIATLHGKILNGVRLKVMLADSPREESNKRQRTY
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggacgaagctggcagctctgcgagcggcgggggcttccgcccgggcgtggacagcctg
gacgaaccgcccaacagccgcatcttccttgtgatcagcaagtacacacctgagtcggtg
ctgagggagcgcttctcgccttttggcgacatccaggacatctgggtggtgcgggacaag
cacaccaaggagtccaagggcattgctttcgtcaagttcgcccgcagctcacaggcctgc
agggccatggaggagatgcatggccagtgcctcggccccaacgacaccaagcccatcaag
gttttcattgctcagtcccgatcatctggaagtcaccgagatgttgaagatgaagaactt
acaagaatctttgttatgataccaaagtcctacacagaagaagatctgcgggaaaaattt
aaggtgtatggagatatcgagtattgcagcattattaagaataaagtgactggagaaagt
aaaggtttgggctacgtacgatacttaaaaccatcacaagctgcccaagcaatagaaaac
tgtgatcgaagttttagagcaatcttggctgaacctaaaaataaagcatctgaatcctct
gaacaagattattatagtaatatgaggcaagaagctttgggacatgaacctagagtaaat
atgtttccatttgaacaacaatctgaattttcaagttttgacaagaatgatagccgaggc
caggaagcaatctccaaacgcttgtcagttgtatcaagagttcctttcactgaagaacag
cttttcagcatttttgatatagtaccaggattggaatattgtgaagttcaacgagatcct
tattcaaattatggtcatggagtggttcagtattttaatgtagcatcagctatttatgca
aaatacaaattacatggatttcagtaccctcctgggaaccgaataggtgtttccttcatt
gatgatggaagtaatgcaacagatctccttagaaaaatggcaacacagatggtagctgca
cagcttgcatcaatggtgtggaataacccaagtcagcaacaatttatgcaatttggagga
agctctggatcacagttgcctcaaatccagacagatgttgtacttccatcatgcaaaaaa
aaagctcctgctgaaactcctgtgaaagaaagactttttattgtgtttaatcctcatcct
ttacctttagacgtattagaagatatattctgtcgttttggtaacctgatcgaagtttac
cttgtgtcaggaaaaaatgtggggtatgccaagtatgccgatagaataagtgctaatgat
gccattgccactctacatggaaagattctgaatggggtgagacttaaagttatgctggca
gattcgccaagagaagaatctaacaaacggcaaagaacttactga

DBGET integrated database retrieval system