KEGG   Homo sapiens (human): 129852
Entry
129852            CDS       T01001                                 
Symbol
C2orf73
Name
(RefSeq) chromosome 2 open reading frame 73
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: GDWWSH
Other DBs
NCBI-GeneID: 129852
NCBI-ProteinID: NP_001093866
HGNC: 26861
Ensembl: ENSG00000177994
Pharos: Q8N5S3(Tdark)
UniProt: Q8N5S3
Position
2:54330884..54384193
AA seq 287 aa
MEEKEDKHQQHKIEDAAITYVSENEEIKHEEKPGKSIHHSKSHVGRGRIYYAKFINTNAR
TYNEPFPYIDPKKGPEIQGDWWSHGKALEPVFLPPYDSKSTQRSDFQKPSCPLVLPVKHS
KMQKPSCGIVPLASPGTSAELQNNFIEYISFIHQYDARKTPNEPLQGKRHGAFVQREIKP
GSRPTVPKGAEVLLNTPGSRSSEQSKKTEKGNSAESRMISPGLCQQNSQELLEPKTHLSE
TDVRQAAKACPSTPESREKTSGATQTTVGDALFTRHKPLNPPIKKSE
NT seq 864 nt   +upstreamnt  +downstreamnt
atggaggaaaaggaagataagcatcaacagcataaaatagaggatgctgctataacatat
gtaagtgaaaatgaagaaattaaacacgaagaaaaacctggaaaaagcatacatcattca
aaatcacatgttggaagaggacgtatatattatgctaaattcattaacacaaatgcaaga
acatacaatgaaccatttccctacatagatcccaaaaaagggccagaaatacagggtgac
tggtggtcacatggtaaagcactggaacctgtcttcctaccaccttacgactctaagagc
acccagaggagtgacttccaaaaaccatcgtgtccactggttttgccagtcaaacacagc
aagatgcaaaagccttcttgtggaatagtaccacttgcctctcctggtacatcagcagaa
cttcaaaacaattttatagaatacatctcttttatacatcaatatgatgccagaaaaact
ccgaatgagcctctccagggaaagagacacggagcttttgtacagagagagataaaacca
ggcagtaggccaacagttcctaaaggagcagaggtattactgaacactccagggtcacgt
tcatcagaacagtccaaaaaaacagagaaaggaaactcagcggaaagcagaatgatctca
ccaggtctctgccaacaaaattctcaggagctgttagagcctaaaactcacttatcagaa
acagacgtcagacaggcagccaaggcatgccccagcactcctgagagcagagaaaagacc
tcaggcgccactcaaacaactgtaggagatgctcttttcactaggcacaagcctttaaat
ccaccaattaaaaaatcagaataa

DBGET integrated database retrieval system