KEGG   Homo sapiens (human): 130Help
Entry
130               CDS       T01001                                 

Gene name
ADH6, ADH-5
Definition
(RefSeq) alcohol dehydrogenase 6 (class V)
  KO
K13952  alcohol dehydrogenase 6 [EC:1.1.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00071  Fatty acid degradation
hsa00350  Tyrosine metabolism
hsa00830  Retinol metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    130 (ADH6)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    130 (ADH6)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    130 (ADH6)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    130 (ADH6)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    130 (ADH6)
   00982 Drug metabolism - cytochrome P450
    130 (ADH6)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    130 (ADH6)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     130 (ADH6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 UDPG_MGDP_dh_N IGFBP 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-GeneID: 130
NCBI-ProteinID: NP_000663
OMIM: 103735
HGNC: 255
Ensembl: ENSG00000172955
Vega: OTTHUMG00000131024
Pharos: P28332(Tbio)
UniProt: P28332 Q8IUN7
Position
4q23
AA seq 368 aa AA seqDB search
MSTTGQVIRCKAAILWKPGAPFSIEEVEVAPPKAKEVRIKVVATGLCGTEMKVLGSKHLD
LLYPTILGHEGAGIVESIGEGVSTVKPGDKVITLFLPQCGECTSCLNSEGNFCIQFKQSK
TQLMSDGTSRFTCKGKSIYHFGNTSTFCEYTVIKEISVAKIDAVAPLEKVCLISCGFSTG
FGAAINTAKVTPGSTCAVFGLGGVGLSVVMGCKAAGAARIIGVDVNKEKFKKAQELGATE
CLNPQDLKKPIQEVLFDMTDAGIDFCFEAIGNLDVLAAALASCNESYGVCVVVGVLPASV
QLKISGQLFFSGRSLKGSVFGGWKSRQHIPKLVADYMAEKLNLDPLITHTLNLDKINEAV
ELMKTGKW
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtactacaggccaagtcatcagatgcaaagcagccatactctggaagcctggtgca
ccattttctattgaagaggtagaagtggccccaccaaaggcaaaggaagttcgcataaag
gttgtggccaccggactgtgtggtacagagatgaaagtgttggggagtaaacacttggac
ctcttgtatcccaccatcttgggccatgaaggggctggaatcgttgagagtattggagaa
ggagtaagcacagtgaaaccaggtgacaaagttatcacactctttctgccacagtgtgga
gaatgtacctcttgcctgaattctgagggcaatttttgtatacaattcaaacagtcaaaa
acccaactgatgtctgatggtaccagcaggtttacctgcaagggaaaatcaatatatcac
tttggtaataccagcaccttctgtgaatacacagtgataaaggaaatctcagttgccaag
attgatgcagtcgctcctctagagaaagtatgcctaattagctgtggcttttccactggg
tttggtgctgcaatcaatactgccaaggtgactccaggttctacctgtgctgtgtttggc
ctgggaggagtcggcttgtctgttgtcatgggttgtaaagcagcaggagcagccaggatc
attggagtggatgtcaacaaggagaaatttaagaaggcacaggaattgggtgctactgag
tgcctcaaccctcaggacttaaagaaacccattcaagaagttttatttgatatgacagat
gctggtatagacttctgctttgaggccattggaaatctggacgttctggcagctgccctc
gcctcctgcaatgagagctatggggtctgtgtggttgttggggtgttgcctgccagtgtt
caactcaaaatcagtggccagttgttcttctcaggacgttctttgaagggttctgttttt
ggaggctggaagagcagacagcacatccctaaactggttgctgattatatggcagagaag
ttgaatctagatccactaattactcatactctgaatcttgataaaatcaatgaagcagtt
gaattaatgaaaactggaaaatggtaa

DBGET integrated database retrieval system