KEGG   Homo sapiens (human): 1300Help
Entry
1300              CDS       T01001                                 

Gene name
COL10A1
Definition
(RefSeq) collagen type X alpha 1 chain
  KO
K19479  collagen, type X, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Disease
H00479  Metaphyseal dysplasias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    1300 (COL10A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen C1q BclA_C
Motif
Other DBs
NCBI-GeneID: 1300
NCBI-ProteinID: NP_000484
OMIM: 120110
HGNC: 2185
Ensembl: ENSG00000123500
Vega: OTTHUMG00000015426
Pharos: Q03692(Tbio)
UniProt: Q03692
Structure
PDB: 

Position
6q22.1
AA seq 680 aa AA seqDB search
MLPQIPFLLLVSLNLVHGVFYAERYQMPTGIKGPLPNTKTQFFIPYTIKSKGIAVRGEQG
TPGPPGPAGPRGHPGPSGPPGKPGYGSPGLQGEPGLPGPPGPSAVGKPGVPGLPGKPGER
GPYGPKGDVGPAGLPGPRGPPGPPGIPGPAGISVPGKPGQQGPTGAPGPRGFPGEKGAPG
VPGMNGQKGEMGYGAPGRPGERGLPGPQGPTGPSGPPGVGKRGENGVPGQPGIKGDRGFP
GEMGPIGPPGPQGPPGERGPEGIGKPGAAGAPGQPGIPGTKGLPGAPGIAGPPGPPGFGK
PGLPGLKGERGPAGLPGGPGAKGEQGPAGLPGKPGLTGPPGNMGPQGPKGIPGSHGLPGP
KGETGPAGPAGYPGAKGERGSPGSDGKPGYPGKPGLDGPKGNPGLPGPKGDPGVGGPPGL
PGPVGPAGAKGMPGHNGEAGPRGAPGIPGTRGPIGPPGIPGFPGSKGDPGSPGPPGPAGI
ATKGLNGPTGPPGPPGPRGHSGEPGLPGPPGPPGPPGQAVMPEGFIKAGQRPSLSGTPLV
SANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPRTGIFTCQIPGIYYFS
YHVHVKGTHVWVGLYKNGTPVMYTYDEYTKGYLDQASGSAIIDLTENDQVWLQLPNAESN
GLYSSEYVHSSFSGFLVAPM
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgctgccacaaataccctttttgctgctagtatccttgaacttggttcatggagtgttt
tacgctgaacgataccaaatgcccacaggcataaaaggcccactacccaacaccaagaca
cagttcttcattccctacaccataaagagtaaaggtatagcagtaagaggagagcaaggt
actcctggtccaccaggccctgctggacctcgagggcacccaggtccttctggaccacca
ggaaaaccaggctacggaagtcctggactccaaggagagccagggttgccaggaccaccg
ggaccatcagctgtagggaaaccaggtgtgccaggactcccaggaaaaccaggagagaga
ggaccatatggaccaaaaggagatgttggaccagctggcctaccaggaccccggggccca
ccaggaccacctggaatccctggaccggctggaatttctgtgccaggaaaacctggacaa
cagggacccacaggagccccaggacccaggggctttcctggagaaaagggtgcaccagga
gtccctggtatgaatggacagaaaggggaaatgggatatggtgctcctggtcgtccaggt
gagaggggtcttccaggccctcagggtcccacaggaccatctggccctcctggagtggga
aaaagaggtgaaaatggggttccaggacagccaggcatcaaaggtgatagaggttttccg
ggagaaatgggaccaattggcccaccaggtccccaaggccctcctggggaacgagggcca
gaaggcattggaaagccaggagctgctggagccccaggccagccagggattccaggaaca
aaaggtctccctggggctccaggaatagctgggcccccagggcctcctggctttgggaaa
ccaggcttgccaggcctgaagggagaaagaggacctgctggccttcctgggggtccaggt
gccaaaggggaacaagggccagcaggtcttcctgggaagccaggtctgactggaccccct
gggaatatgggaccccaaggaccaaaaggcatcccgggtagccatggtctcccaggccct
aaaggtgagacagggccagctgggcctgcaggataccctggggctaagggtgaaaggggt
tcccctgggtcagatggaaaaccagggtacccaggaaaaccaggtctcgatggtcctaag
ggtaacccagggttaccaggtccaaaaggtgatcctggagttggaggacctcctggtctc
ccaggccctgtgggcccagcaggagcaaagggaatgcccggacacaatggagaggctggc
ccaagaggtgcccctggaataccaggtactagaggccctattgggccaccaggcattcca
ggattccctgggtctaaaggggatccaggaagtcccggtcctcctggcccagctggcata
gcaactaagggcctcaatggacccaccgggccaccagggcctccaggtccaagaggccac
tctggagagcctggtcttccagggccccctgggcctccaggcccaccaggtcaagcagtc
atgcctgagggttttataaaggcaggccaaaggcccagtctttctgggacccctcttgtt
agtgccaaccagggggtaacaggaatgcctgtgtctgcttttactgttattctctccaaa
gcttacccagcaataggaactcccataccatttgataaaattttgtataacaggcaacag
cattatgacccaaggactggaatctttacttgtcagataccaggaatatactatttttca
taccacgtgcatgtgaaagggactcatgtttgggtaggcctgtataagaatggcacccct
gtaatgtacacctatgatgaatacaccaaaggctacctggatcaggcttcagggagtgcc
atcatcgatctcacagaaaatgaccaggtgtggctccagcttcccaatgccgagtcaaat
ggcctatactcctctgagtatgtccactcctctttctcaggattcctagtggctccaatg
tga

DBGET integrated database retrieval system