KEGG   Homo sapiens (human): 130013
Entry
130013            CDS       T01001                                 

Gene name
ACMSD
Definition
(RefSeq) aminocarboxymuconate semialdehyde decarboxylase
  KO
K03392  aminocarboxymuconate-semialdehyde decarboxylase [EC:4.1.1.45]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00380  Tryptophan metabolism
hsa01100  Metabolic pathways
Module
hsa_M00038  Tryptophan metabolism, tryptophan => kynurenine => 2-aminomuconate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    130013 (ACMSD)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.45  aminocarboxymuconate-semialdehyde decarboxylase
     130013 (ACMSD)
SSDB
Motif
Pfam: Amidohydro_2 DUF2963
Other DBs
NCBI-GeneID: 130013
NCBI-ProteinID: NP_612199
OMIM: 608889
HGNC: 19288
Ensembl: ENSG00000153086
Vega: OTTHUMG00000131711
Pharos: Q8TDX5(Tbio)
UniProt: Q8TDX5
Structure
PDB: 
4OFC 2WM1 4IGN 4IGM 4IH3

Position
2q21.3
AA seq 336 aa
MKIDIHSHILPKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRI
REMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQ
APELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQM
DGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGF
SMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELE
PGKLIESMEEFDEETKNKLKAGNALAFLGLERKQFE
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgaaaattgacatccatagtcatattctaccaaaagaatggccagatctaaaaaagagg
tttggctacggaggctgggtgcagctccaacaccacagcaagggagaagcaaagttgttg
aaagatgggaaagtcttcagagtggtgcgagagaattgctgggatccagaagttcgtatt
agagaaatggaccaaaaaggagtaacagtgcaagccctttccacagttcctgtcatgttt
agctactgggccaaacctgaggacactttaaacctgtgccagcttttaaacaacgacctt
gccagcaccgttgtgagctaccccaggaggttcgtgggtctggggacgttgcccatgcag
gcccctgagctggcggtcaaggagatggagcgctgtgtgaaagagctgggctttcccggg
gtccaaattggcacccacgtcaacgagtgggacctgaacgcgcaggagctctttcctgtc
tatgcggcagccgaaaggctgaagtgttccctgttcgtgcatccctgggacatgcagatg
gatggacgaatggccaaatactggctcccttggcttgtaggaatgccagcagagaccacc
atagccatttgctccatgatcatgggtggagtatttgagaagtttcccaaactgaaagtg
tgtttcgcacatggtggtggtgccttccccttcacagtgggaagaatctcccatggattc
agcatgcgcccagatctgtgtgcccaggacaaccccatgaacccgaagaaataccttggt
tccttttacacagatgctttggttcatgatcctctgtccctcaagctgttaacagatgtc
ataggaaaggataaagtcattttgggaaccgattacccctttccactaggtgagctggaa
cctgggaaactaatagagtccatggaagaatttgatgaagaaacaaagaataaactcaaa
gccggcaatgccctggcatttttgggtcttgagagaaaacaatttgaatga

DBGET integrated database retrieval system