KEGG   Homo sapiens (human): 130026
Entry
130026            CDS       T01001                                 
Symbol
ICA1L, ALS2CR14, ALS2CR15
Name
(RefSeq) islet cell autoantigen 1 like
  KO
K19864  islet cell autoantigen 1-like protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    130026 (ICA1L)
SSDB
Motif
Pfam: Arfaptin ICA69 XET_C
Other DBs
NCBI-GeneID: 130026
NCBI-ProteinID: NP_001275551
HGNC: 14442
Ensembl: ENSG00000163596
Pharos: Q8NDH6(Tdark)
UniProt: Q8NDH6 A0A024R3W3
Position
2:complement(202773176..202871766)
AA seq 482 aa
MDSFGQPRPEDNQSVVRRMQKKYWKTKQVFIKATGKKEDEHLVASDAELDAKLEVFHSVQ
ETCTELLKIIEKYQLRLNVISEEENELGLFLKFQAERDATQAGKMMDATGKALCSSAKQR
LALCTPLSRLKQEVATFSQRAVSDTLMTINRMEQARTEYRGALLWMKDVSQELDPDTLKQ
MEKFRKVQMQVRNSKASFDKLKMDVCQKVDLLGASRCNMLSHSLTTYQRTLLGFWKKTAR
MMSQIHEACIGFHPYDFVALKQLQDTPSKISEDNKDEQIGGFLTEQLNKLVLSDEEASFE
SEQANKDHNEKHSQMREFGAPQFSNSENVAKDLPVDSLEGEDFEKEFSFLNNLLSSGSSS
TSEFTQECQTAFGSPSASLTSQEPSMGSEPLAHSSRFLPSQLFDLGFHVAGAFNNWVSQE
ESELCLSHTDNQPVPSQSPKKLTRSPNNGNQDMSAWFNLFADLDPLSNPDAIGHSDDELL
NA
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggattcctttgggcaacccagaccagaagataatcagtcagtagtcagaagaatgcaa
aagaaatactggaaaactaaacaggtctttatcaaagcaacaggaaaaaaagaggatgag
cacttggtggcgtctgatgctgaactggatgctaaacttgaggtttttcactctgttcaa
gagacatgcactgaacttctgaagataatcgagaaataccagctaagactcaatgttata
tcagaggaagaaaatgagctagggctctttttaaaatttcaagcagaacgggatgcaact
caagctggcaaaatgatggatgccactggcaaggcactttgttcttcagccaagcaaaga
ttggccctgtgtactcctctgtctcgtctgaagcaagaagtagcaacattcagtcaaagg
gcagtatctgataccttgatgacaattaatcggatggagcaggcacgcacagaatacaga
ggagctctactgtggatgaaagatgtatcccaagagctggacccagacaccttaaagcaa
atggaaaagtttagaaaagtacagatgcaagtgagaaatagcaaagcttcttttgacaag
ttaaagatggatgtttgtcagaaagtggatttacttggagctagtcgctgcaatatgcta
tctcattcgctcactacctaccagagaacactgcttggattctggaagaaaacagctcga
atgatgtcccaaattcatgaagcctgtattggctttcatccgtatgattttgtagctctc
aagcaactacaagacacgccaagcaagattagtgaagacaataaagatgaacaaataggc
ggttttcttactgaacagctcaataagctagttttgtctgatgaggaagcaagctttgag
agtgaacaagcaaacaaagatcacaatgaaaaacattctcaaatgagagaatttggagca
cctcagttttctaactctgaaaatgttgcaaaagatctacctgtagattcattggaagga
gaagattttgagaaggaattctcatttctgaacaacctcctaagttctggttcttcaagt
actagtgaatttacccaagaatgccagactgcctttgggagccccagtgccagtctcaca
tcccaggagccttccatggggtctgagcccctcgctcattcttctcgattccttccttca
caactctttgaccttggctttcatgtggctggagcgttcaacaactgggtctcccaagag
gaatcagaactttgtctttcacacactgataaccagccagtgccttcacagagtccaaag
aaattaacaagatcccccaacaatggcaaccaagacatgtcagcctggttcaatctgttt
gcagacttggatccactttcaaacccagatgctattggacactcagatgatgaacttctt
aatgcttga

DBGET integrated database retrieval system