KEGG   Homo sapiens (human): 130162
Entry
130162            CDS       T01001                                 
Symbol
CLHC1, C2orf63
Name
(RefSeq) clathrin heavy chain linker domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: TSNAXIP1_N Clathrin_H_link Nucleopor_Nup85
Other DBs
NCBI-GeneID: 130162
NCBI-ProteinID: NP_689598
HGNC: 26453
Ensembl: ENSG00000162994
Pharos: Q8NHS4(Tdark)
UniProt: Q8NHS4
Position
2:complement(55172547..55232563)
AA seq 586 aa
MSVHQIRKHAVLPPIICRSDKEFLESVQRYIITETERLGCSEEGPADEYYIIYRNVFDKV
IEHITAYKSILTSIKKEYDAFIETIKKDRRTTFCLHGKLKGLAAEPTALVYYRKRTIQLE
AKMRIIESNSSKIQSQIDHIKQCRAEYDTKEVKYCTFSKDPSKPIPGMTLQESMNLDALT
KYMKHLEDKYAEIKQAMLIKYVPAQRKADLDEEMIVLLKRRDVAENLNKKLQFCHQRLQI
ISQALSSWVKSDMSSPFQDFVEQIQKTKYLQGDQGIVEELMEDDPRRAKEAEIMLHYIER
FNELISLGEYEKAACYAANSPRRILRNIGTMNTFKAVGKIRGKPLPLLLFFEALFITSHA
FPCPVDAALTLEGIKCGLSEKRLDLVTNWVTQERLTFSEEAGDVICDYGEQDTYNKAKCL
ALAQIVYSECGLHKKAILCLCKQGQTHRVMEYIQQLKDFTTDDLLQLLMSCPQVELIQCL
TKELNEKQPSLSFGLAILHLFSADMKKVGIKLLQEINKGGIDAVESLMINDSFCSIEKWQ
EVANICSQNGFDKLSNDITSILRSQAAVTEISEEDDAVNLMEHVFW
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgtcagttcatcaaataagaaaacatgcagttctcccacctatcatttgtagaagtgac
aaggaatttttggaaagtgtgcaaagatacataattacagaaactgaaagactgggctgt
agtgaggaaggacctgctgatgaatattacatcatataccgaaatgtttttgataaggta
atagagcatatcactgcatacaaatccattcttacttcaatcaaaaaagaatatgatgcc
tttattgagacaataaagaaagaccgaagaactacattttgtcttcatggaaaacttaaa
ggtttggcagcagagcctacagctttggtatattacaggaaaagaacaatccaacttgaa
gcaaaaatgaggattatcgaaagtaattcctcgaagattcaatctcaaatagatcacatc
aagcagtgtagggcagagtatgacacaaaagaagtaaaatattgtactttctccaaagat
ccttcaaaacctattccaggcatgactcttcaagaatccatgaatctagatgctctcact
aaatacatgaaacatcttgaagataaatatgcagaaattaaacaagctatgttgataaaa
tatgtgccagctcagaggaaggctgatttagatgaagaaatgattgtgttattaaaacgg
cgagatgtagctgaaaatctgaacaaaaaattgcagttttgtcatcaaagactgcagata
atttcacaggcacttagttcatgggtaaaatctgatatgagcagcccatttcaagacttt
gtggagcaaattcagaaaaccaaatatttacaaggtgaccaaggcattgttgaagaacta
atggaagatgatccacgcagggcaaaagaagctgaaattatgcttcactacattgaaagg
tttaatgagttaatctcacttggtgaatatgaaaaggcagcttgttatgcagcaaacagt
cctagaagaattcttcgaaacattggtacaatgaatacatttaaggctgttggaaaaatt
agaggaaagcctcttccattactcttattttttgaggccctctttatcacaagtcatgct
tttccatgtcctgttgatgcagctctaaccctggaaggaatcaaatgtggattatcagaa
aaacggttagatttagttaccaattgggttacacaggaaagactgacattttctgaggag
gctggggatgtgatttgtgattatggggagcaggatacttataacaaggccaagtgcctg
gctttagctcagattgtctacagtgaatgtggcctgcacaagaaagctattctttgcttg
tgtaaacagggtcagactcatagggtcatggagtacatacagcagttgaaggactttact
accgatgacctgttgcagctattaatgtcatgtccccaagttgaattaattcagtgtctc
actaaagagttgaatgagaaacaaccatctttatcttttggtcttgctatacttcatctg
ttctctgcagacatgaaaaaagttggcattaagctacttcaagaaatcaataaaggtggg
atagatgcagtagaaagtcttatgataaatgattccttttgctccatagaaaagtggcaa
gaagtggcaaatatatgttcacagaatggctttgacaaattatctaatgacatcacgtct
attcttcgatctcaggctgcagttacagaaatttctgaagaggatgacgcagtcaaccta
atggaacatgtgttttggtag

DBGET integrated database retrieval system