KEGG   Homo sapiens (human): 130497
Entry
130497            CDS       T01001                                 

Gene name
OSR1, ODD
Definition
(RefSeq) odd-skipped related transcription factor 1
  KO
K09215  odd-skipped
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    130497 (OSR1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    130497 (OSR1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz C1_4 Zn-ribbon_8 XPA_N zf-AN1 GAGA zf-met CpXC DUF4379
Other DBs
NCBI-GeneID: 130497
NCBI-ProteinID: NP_660303
OMIM: 608891
HGNC: 8111
Ensembl: ENSG00000143867
Vega: OTTHUMG00000088793
Pharos: Q8TAX0(Tbio)
UniProt: Q8TAX0
Position
2p24.1
AA seq 266 aa
MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYP
AMHLPRSSFSKVPGTVSSLVDARFQLPAFPWFPHVIQPKPEITAGGSVPALKTKPRFDFA
NLALAATQEDPAKLGRGEGPGSPAGGLGALLDVTKLSPEKKPTRGRLPSKTKKEFVCKFC
GRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGF
CQSRTLAVHKTLHSQVKELKTSKIKC
NT seq 801 nt   +upstreamnt  +downstreamnt
atgggcagcaaaaccttgccggcgccggtgcctatccacccttccctgcagctcaccaac
tactccttccttcaggcagtgaacggcctgcccacagtgccttcggaccatctgcccaac
ctgtatggtttcagcgcgttgcacgctgtgcacctgcatcagtggacgctgggctacccg
gccatgcacttgccgcgctcttctttctccaaagtgccgggcacggtgtccagcttggtg
gatgcgcgcttccagctgcccgcctttccctggttccctcatgtcattcaacccaagccc
gagatcaccgctggaggcagcgttccagcgctcaagaccaagccgcgctttgattttgcc
aacctggccttggcagcaacgcaagaagatccggccaagctcggtcgcggggagggccca
ggctcccctgcaggtgggctgggtgccctcctcgacgtgaccaagctgtctccagaaaag
aagcccacaaggggacgtctgccttccaagaccaagaaggaattcgtctgcaagttctgt
ggccgccacttcaccaagtcctacaacctacttatccatgagcggacgcacaccgacgag
cggccctacacctgtgacatctgccacaaagccttccggaggcaagaccacctgcgagac
cacagatatattcactccaaagagaagcccttcaagtgtcaagagtgtgggaaaggattc
tgccagtccaggactctcgctgtccacaagacgctacactcacaggtgaaggagctcaaa
acctccaagatcaaatgctaa

DBGET integrated database retrieval system