KEGG   Homo sapiens (human): 130540
Entry
130540            CDS       T01001                                 
Symbol
FLACC1, ALS2CR12
Name
(RefSeq) flagellum associated containing coiled-coil domains 1
  KO
K25631  flagellum-associated coiled-coil domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    130540 (FLACC1)
Cilium and associated proteins [BR:hsa03037]
 Motile cilia and associated proteins
  Sperm flagellum proteins
   130540 (FLACC1)
SSDB
Motif
Pfam: DUF6482
Other DBs
NCBI-GeneID: 130540
NCBI-ProteinID: NP_631902
OMIM: 619796
HGNC: 14439
Ensembl: ENSG00000155749
Pharos: Q96Q35(Tdark)
UniProt: Q96Q35
Position
2:complement(201288271..201364289)
AA seq 445 aa
MYPNPLIYCTCWDPWNLGPRKLIKTPQLPRKNSTGSSKLTPLVPAPKNHNYLQPTKPVVS
PKMKIHSARQEETNKSFYEVINVSPGYQLVRNREQISVTLGDEMFDRKKRWESEIPDKGR
FSRTNIISDLEEQISELTAIIEQMNRDHQSAQKLLSSEMDLRCAEMKQNFENKNRELKEA
HEAELSELENNYKAALKAEKLAAQEKLEEMGKEYKYLKNMFRTYQDSIYDEMEEKWSKQK
AKWKKDEKFERENILLQQKKKMTKKFEMESGEEDKKINESCSAVFENFIQEKEELLKQHQ
SDTLQLEELRKTKEVPWRRDQINRHWHDVLQQLLLMQVMQEELHAQALILESLNTNLYYT
QLELQKEKAIVGNLEKMLQTKFAETEEKYKHTIQILTEENIHLKQKIISKNEEICEGCSG
RLASITVSKDDSDTVQDGSKKGQES
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgtaccccaaccctctcatctactgcacctgctgggacccctggaacttgggaccacgg
aagctaatcaagacccctcaactaccacgcaagaactccacagggagttccaagctaact
cctcttgtaccagctccaaaaaatcacaattacctccaaccaacaaaacctgttgtttcc
ccaaaaatgaaaatccattcagcaaggcaagaagagactaataaatcattttatgaagtg
atcaacgtgtcacctggctatcaacttgttcggaatcgggaacagatttctgtcacctta
ggggatgagatgtttgataggaaaaagcggtgggaatcggagatcccggacaaaggcaga
ttttccaggaccaacatcatttctgacctagaagagcaaatctcagagctgacagcaata
attgaacaaatgaacagagaccaccagtctgcccagaaattgctctccagtgaaatggat
ctccgctgtgctgagatgaaacagaactttgaaaacaagaacagggagctcaaagaggcc
catgaagcagaactcagtgagttggagaacaactacaaagcagccttgaaggcagagaag
ttggctgcccaagagaagctagaggagatgggaaaagaatacaagtatttgaagaatatg
tttcgtacgtatcaggacagtatttatgatgaaatggaagagaagtggtcaaaacagaag
gcgaaatggaagaaggatgagaagttcgagcgagaaaatatcctgctacagcaaaaaaaa
aagatgaccaaaaaattcgaaatggagtcaggagaagaagataagaaaataaatgaatcc
tgcagtgctgtctttgagaacttcattcaagagaaggaggagctcttgaaacaacatcaa
agtgacaccttgcaattagaagagctgagaaaaaccaaagaggtgccctggagaagagac
caaataaatagacattggcatgatgtcctgcaacagcttcttcttatgcaggtcatgcag
gaagaattgcatgcacaagcccttatcctagagtcactgaacacaaacctctactatacc
cagttggaactccagaaagagaaagctatagtgggaaatctggagaaaatgcttcaaacc
aagtttgctgaaactgaagaaaagtataagcacaccatacagatcctgacggaagagaac
attcatctgaagcaaaagataatttctaagaatgaagaaatttgtgaaggatgttctggg
agattggcctctattactgtttctaaggatgattctgacactgtgcaagatggtagcaag
aaaggacaagaatcataa

DBGET integrated database retrieval system