KEGG   Homo sapiens (human): 1306Help
Entry
1306              CDS       T01001                                 

Gene name
COL15A1
Definition
(RefSeq) collagen type XV alpha 1 chain
  KO
K08135  collagen, type XV, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    1306 (COL15A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    1306 (COL15A1)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Basement membrane proteoglycans
   1306 (COL15A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Endostatin Collagen Laminin_G_3 Laminin_G_2
Motif
Other DBs
NCBI-GeneID: 1306
NCBI-ProteinID: NP_001846
OMIM: 120325
HGNC: 2192
Ensembl: ENSG00000204291
Vega: OTTHUMG00000020351
Pharos: P39059(Tbio)
UniProt: P39059 B3KTP7
Structure
PDB: 

Position
9q22.33
AA seq 1388 aa AA seqDB search
MAPRRNNGQCWCLLMLLSVSTPLPAVTQTRGATETASQGHLDLTQLIGVPLPSSVSFVTG
YGGFPAYSFGPGANVGRPARTLIPSTFFRDFAISVVVKPSSTRGGVLFAITDAFQKVIYL
GLRLSGVEDGHQRIILYYTEPGSHVSQEAAAFSVPVMTHRWNRFAMIVQGEEVTLLVNCE
EHSRIPFQRSSQALAFESSAGIFMGNAGATGLERFTGSLQQLTVHPDPRTPEELCDPEES
SASGETSGLQEADGVAEILEAVTYTQASPKEAKVEPINTPPTPSSPFEDMELSGEPVPEG
TLETTNMSIIQHSSPKQGSGEILNDTLEGVHSVDGDPITDSGSGAGAFLDIAEEKNLAAT
AAGLAEVPISTAGEAEASSVPTGGPTLSMSTENPEEGVTPGPDNEERLAATAAGEAEALA
SMPGEVEASGVAPGELDLSMSAQSLGEEATVGPSSEDSLTTAAAATEVSLSTFEDEEASG
VPTDGLAPLTATMAPERAVTSGPGDEEDLAAATTEEPLITAGGEESGSPPPDGPPLPLPT
VAPERWITPAQREHVGMKGQAGPKGEKGDAGEELPGPPEPSGPVGPTAGAEAEGSGLGWG
SDVGSGSGDLVGSEQLLRGPPGPPGPPGLPGIPGKPGTDVFMGPPGSPGEDGPAGEPGPP
GPEGQPGVDGATGLPGMKGEKGARGPNGSVGEKGDPGNRGLPGPPGKKGQAGPPGVMGPP
GPPGPPGPPGPGCTMGLGFEDTEGSGSTQLLNEPKLSRPTAAIGLKGEKGDRGPKGERGM
DGASIVGPPGPRGPPGHIKVLSNSLINITHGFMNFSDIPELVGPPGPDGLPGLPGFPGPR
GPKGDTGLPGFPGLKGEQGEKGEPGAILTEDIPLERLMGKKGEPGMHGAPGPMGPKGPPG
HKGEFGLPGRPGRPGLNGLKGTKGDPGVIMQGPPGLPGPPGPPGPPGAVINIKGAIFPIP
VRPHCKMPVDTAHPGSPELITFHGVKGEKGSWGLPGSKGEKGDQGAQGPPGPPLDLAYLR
HFLNNLKGENGDKGFKGEKGEKGDINGSFLMSGPPGLPGNPGPAGQKGETVVGPQGPPGA
PGLPGPPGFGRPGDPGPPGPPGPPGPPAILGAAVALPGPPGPPGQPGLPGSRNLVTAFSN
MDDMLQKAHLVIEGTFIYLRDSTEFFIRVRDGWKKLQLGELIPIPADSPPPPALSSNPHQ
LLPPPNPISSANYEKPALHLAALNMPFSGDIRADFQCFKQARAAGLLSTYRAFLSSHLQD
LSTIVRKAERYSLPIVNLKGQVLFNNWDSIFSGHGGQFNMHIPIYSFDGRDIMTDPSWPQ
KVIWHGSSPHGVRLVDNYCEAWRTADTAVTGLASPLSTGKILDQKAYSCANRLIVLCIEN
SFMTDARK
NT seq 4167 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaggaggaacaacgggcagtgctggtgtctgctgatgctgctctcggtctcc
acgcccctccctgctgtcacccagacccgcggtgcgacagagactgcttcccagggtcac
ctggacctcacgcagctcatcggtgtcccgctgccctcgtccgtatcctttgtcacaggc
tatggtggcttcccggcctacagtttcgggcctggtgccaatgttggccgcccagccagg
actctcatcccatccaccttcttcagggacttcgccatcagcgtcgtggtgaagcccagc
agcacccgtggtggcgtgctcttcgccatcactgacgccttccagaaggtcatctacctg
ggcctgcggctctcaggtgtggaggacggccaccagcggatcatcctctactacacggag
ccaggctcccatgtgtcccaagaggctgctgccttctcggtgcctgtgatgacccacagg
tggaaccgcttcgccatgattgtccagggtgaggaagtgaccctcctcgtgaactgtgag
gagcacagccgcatccccttccagcggtcctcccaggctttggcttttgagtccagcgct
ggaatcttcatgggcaatgcaggagctacagggctcgagagattcactggctccctccag
cagctcaccgtgcaccccgaccccaggactcccgaggagctgtgtgaccctgaagagtcc
tcggcatctggagagaccagtgggctgcaggaggcagacggagtagctgagatcttagaa
gccgtcacctacactcaagcctcgcccaaagaagcaaaagttgaacccataaacacacct
ccaactccatcctccccctttgaagacatggaactttctggtgaacctgtacccgagggg
accctggaaaccaccaacatgagcatcatccagcacagcagccccaaacaagggtctggt
gagatcctgaatgacacactggagggggttcattctgtggatggtgaccccattactgac
agcggctcaggggctggggccttccttgacattgctgaagaaaagaatttagcagcaaca
gcagcggggctggccgaggtgcccatcagcactgctggagaagcagaggccagcagtgtg
cccaccgggggaccaaccctctctatgtccacggagaacccagaggaaggggtcactcca
ggtccagataatgaagagcgtttagcagcaacagcagcaggggaggccgaggcactcgcc
agcatgcctggggaagtggaggccagtggtgtggcccccggggagctggacctctccatg
tccgcccagagcctcggggaagaggccactgtgggtccaagcagtgaagacagtttaaca
acagctgcagctgcaaccgaagtgtccctcagtacttttgaggatgaggaagccagtggg
gtccccacagatggcctggctcccctcacagccaccatggcccctgagcgggcagtcact
tctggtcctggtgatgaagaagacttggcagcagccacaacagaggagcccctcatcaca
gctgggggtgaagagtccggcagccctccccctgatgggccaccgctgcccctgcccaca
gtggctcctgaaagatggatcactccagctcaaagagaacatgtgggaatgaaaggacag
gctgggcccaaaggagaaaagggtgatgctggggaggagcttcctggccctcctgaacct
tctgggcctgttggacccacggcaggagcagaagcagagggctctggcctaggctggggc
tcggacgtcggctctggctctggtgacctggtgggcagtgagcagctgctgagaggtcct
ccaggacccccagggccacctggcttacctgggattccaggaaaaccaggaactgatgtt
ttcatgggaccccctggatctcctggagaggatggacctgctggtgaacctgggcccccg
ggccctgagggacagcctggagttgatggagccaccggccttcccgggatgaaaggggag
aagggagcaagagggcctaatggctcagttggtgaaaagggtgaccctggcaacagaggc
ttacctggacccccggggaaaaagggacaagctggccctcctggggtcatgggaccccca
gggcctcctggaccccctgggcccccaggccctggatgcacaatgggacttggattcgag
gataccgaaggctctggaagcacccagctattgaatgaacccaaactctccagaccaacg
gctgcaattggtctcaaaggagagaaaggagaccggggacccaagggagaaagggggatg
gatggagccagtattgtgggaccccctgggccgagagggccacctgggcacatcaaggtc
ttgtctaattccttgatcaatatcacccatggattcatgaatttctcggacattcctgag
ctggtggggcctccggggccggacgggttgcctgggctgccaggatttccaggtcctaga
ggaccaaaaggtgacactggtttacctggctttccaggactaaaaggagaacagggcgag
aagggagagccgggtgccatcctgacagaggacattcctctggaaaggctgatggggaaa
aagggtgaacctggaatgcatggagccccaggaccaatggggcccaaaggaccaccagga
cataaaggagaatttggccttcccgggcgacctggtcgcccaggactgaatggcctcaag
ggtaccaaaggagatccaggggtcattatgcagggcccacctggcttacctggccctcca
ggcccccctgggccacctggagctgtgattaacatcaaaggagccattttcccaataccc
gtccgaccacactgcaaaatgccagttgatactgctcatcctgggagtccagagctcatc
acttttcacggtgttaaaggagagaaaggatcctggggtcttcctggctcaaagggagaa
aaaggcgaccagggagcccagggaccaccaggtcctccacttgatctagcttacctgaga
cactttctgaacaacttgaagggggagaatggagacaaggggttcaaaggtgaaaaagga
gaaaaaggagacattaatggcagcttccttatgtctgggcctccaggcctgcccggaaat
ccaggcccggctggccaaaaaggggagacagtcgttgggccccaaggacccccaggtgct
cctggtctgcctgggccacctggctttggaagacctggtgatcctgggccaccggggccc
ccggggccaccaggacctccagctatcctgggagcagctgtggcccttccaggtccccct
ggccctccaggacagccagggcttcccggatccagaaacctggtcacagcattcagcaac
atggatgacatgctgcagaaagcgcatttggttatagaaggaacattcatctacctgagg
gacagcactgagtttttcattcgtgttagagatggctggaaaaaattacagctgggagaa
ctgatccccattcctgccgacagccctccaccccctgcgctttccagcaacccacatcag
cttctgcctccaccaaaccctatttcaagtgccaattatgagaagcctgctctgcatttg
gctgctctgaacatgccattttctggggacattcgagctgattttcagtgcttcaagcag
gccagagctgcaggactgttgtccacctaccgagcattcttatcttcccatttgcaagat
ctgtccaccattgtgaggaaagcagagagatacagccttcccatagtgaacctcaagggc
caagtactttttaataattgggactcaattttttctggccacggaggtcagttcaatatg
catattccaatatactcctttgatggtcgagacataatgacagatccttcttggccccag
aaagtcatttggcatggctccagcccccatggcgtccgccttgtggataactactgtgaa
gcatggcgaaccgcggacacagcggtcacgggacttgcctccccgctgagcacggggaag
attctggaccagaaagcatacagctgtgctaatcggctaattgtcctatgtatcgaaaac
agtttcatgacagacgctaggaagtaa

DBGET integrated database retrieval system