KEGG   Homo sapiens (human): 1307Help
Entry
1307              CDS       T01001                                 

Gene name
COL16A1, 447AA, FP1572
Definition
(RefSeq) collagen type XVI alpha 1 chain
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen Laminin_G_2 DUF5330
Motif
Other DBs
NCBI-GeneID: 1307
NCBI-ProteinID: NP_001847
OMIM: 120326
HGNC: 2193
Ensembl: ENSG00000084636
Vega: OTTHUMG00000003883
Pharos: Q07092(Tbio)
UniProt: Q07092
Position
1p35.2
AA seq 1604 aa AA seqDB search
MWVSWAPGLWLLGLWATFGHGANTGAQCPPSQQEGLKLEHSSSLPANVTGFNLIHRLSLM
KTSAIKKIRNPKGPLILRLGAAPVTQPTRRVFPRGLPEEFALVLTLLLKKHTHQKTWYLF
QVTDANGYPQISLEVNSQERSLELRAQGQDGDFVSCIFPVPQLFDLRWHKLMLSVAGRVA
SVHVDCSSASSQPLGPRRPMRPVGHVFLGLDAEQGKPVSFDLQQVHIYCDPELVLEEGCC
EILPAGCPPETSKARRDTQSNELIEINPQSEGKVYTRCFCLEEPQNSEVDAQLTGRISQK
AERGAKVHQETAADECPPCVHGARDSNVTLAPSGPKGGKGERGLPGPPGSKGEKGARGND
CVRISPDAPLQCAEGPKGEKGESGALGPSGLPGSTGEKGQKGEKGDGGIKGVPGKPGRDG
RPGEICVIGPKGQKGDPGFVGPEGLAGEPGPPGLPGPPGIGLPGTPGDPGGPPGPKGDKG
SSGIPGKEGPGGKPGKPGVKGEKGDPCEVCPTLPEGFQNFVGLPGKPGPKGEPGDPVPAR
GDPGIQGIKGEKGEPCLSCSSVVGAQHLVSSTGASGDVGSPGFGLPGLPGRAGVPGLKGE
KGNFGEAGPAGSPGPPGPVGPAGIKGAKGEPCEPCPALSNLQDGDVRVVALPGPSGEKGE
PGPPGFGLPGKQGKAGERGLKGQKGDAGNPGDPGTPGTTGRPGLSGEPGVQGPAGPKGEK
GDGCTACPSLQGTVTDMAGRPGQPGPKGEQGPEGVGRPGKPGQPGLPGVQGPPGLKGVQG
EPGPPGRGVQGPQGEPGAPGLPGIQGLPGPRGPPGPTGEKGAQGSPGVKGATGPVGPPGA
SVSGPPGRDGQQGQTGLRGTPGEKGPRGEKGEPGECSCPSQGDLIFSGMPGAPGLWMGSS
WQPGPQGPPGIPGPPGPPGVPGLQGVPGNNGLPGQPGLTAELGSLPIEQHLLKSICGDCV
QGQRAHPGYLVEKGEKGDQGIPGVPGLDNCAQCFLSLERPRAEEARGDNSEGDPGCVGSP
GLPGPPGLPGQRGEEGPPGMRGSPGPPGPIGPPGFPGAVGSPGLPGLQGERGLTGLTGDK
GEPGPPGQPGYPGATGPPGLPGIKGERGYTGSAGEKGEPGPPGSEGLPGPPGPAGPRGER
GPQGNSGEKGDQGFQGQPGFPGPPGPPGFPGKVGSPGPPGPQAEKGSEGIRGPSGLPGSP
GPPGPPGIQGPAGLDGLDGKDGKPGLRGDPGPAGPPGLMGPPGFKGKTGHPGLPGPKGDC
GKPGPPGSTGRPGAEGEPGAMGPQGRPGPPGHVGPPGPPGQPGPAGISAVGLKGDRGATG
ERGLAGLPGQPGPPGHPGPPGEPGTDGAAGKEGPPGKQGFYGPPGPKGDPGAAGQKGQAG
EKGRAGMPGGPGKSGSMGPVGPPGPAGERGHPGAPGPSGSPGLPGVPGSMGDMVNYDEIK
RFIRQEIIKMFDERMAYYTSRMQFPMEMAAAPGRPGPPGKDGAPGRPGAPGSPGLPGQIG
REGRQGLPGVRGLPGTKGEKGDIGIGIAGENGLPGPPGPQGPPGYGKMGATGPMGQQGIP
GIPGPPGPMGQPGKAGHCNPSDCFGAMPMEQQYPPMKTMKGPFG
NT seq 4815 nt NT seq  +upstreamnt  +downstreamnt
atgtgggtatcctgggctcctggcctgtggctgctcggtctttgggctaccttcggccat
ggggcaaatacaggtgcacaatgcccaccttcacagcaggaaggactcaaattggaacac
agtagtagcctgccagccaacgtgactggcttcaacctcatccaccgactcagcctcatg
aagacgtctgccatcaagaagatccgcaaccccaaggggcctctcatcctgcgcctgggg
gcggcccccgtgacccagcccacgcgaagagtattccctcggggtctcccggaggagttt
gccctggtgctgacactactgctgaagaaacacacccaccagaagacgtggtatctgttt
caagtgaccgatgcaaatgggtatccacagatatccctggaagtcaacagccaagagcgg
agcctggagctcagggcccagggccaggatggcgactttgtgtcctgcatcttcccagtg
ccccagctcttcgacttgcgttggcacaagctgatgctgagtgtggctggacgtgtggcc
tctgtgcacgtggactgcagctcagcctcctcccagcctctggggccccgacgacccatg
aggcctgtgggccatgtatttctaggcttggatgctgagcagggcaagcctgtctcgttt
gaccttcagcaggtgcacatctactgtgacccggagctcgtgctggaggagggctgctgt
gagattttaccagcagggtgccccccagagacctccaaggcccgccgggacacccagagc
aatgagctcattgagatcaatccacagtctgaaggcaaggtctacacccgctgcttctgc
ctggaggagcctcaaaacagcgaggtggatgcccagctgacgggaagaatcagccagaag
gcagaaaggggagcaaaggtccatcaggagacagcagccgatgagtgtccgccctgtgtc
catggtgcccgggacagcaatgtcacacttgctccctctggccccaagggagggaaaggt
gagcggggcctgcctggtccaccaggctccaagggagagaagggagcacggggcaatgac
tgtgttcgaatctccccggatgccccacttcagtgtgcagaaggcccgaagggagagaag
ggggagtcaggagctctgggaccctcaggactcccaggctcaacaggcgagaagggccag
aaaggcgagaagggcgacggaggcatcaagggcgtgccgggaaagccaggccgggacggc
cggccaggagagatctgtgtcattgggcccaaagggcagaagggagaccctggctttgtt
gggcctgaggggctggcaggagagcctgggccccccggcctccctggaccccctgggata
ggactgcctgggaccccgggggatccaggtggcccaccaggccccaagggagacaagggc
agctcggggatcccaggaaaggaaggccctggtgggaaacctgggaagccaggtgtgaag
ggagagaagggtgacccctgtgaagtgtgcccaacactgcctgaagggttccagaacttt
gttggacttcctggaaagccagggcccaaaggggagcctggtgatcctgtaccagccagg
ggagaccctggcatccaaggcatcaaaggagagaagggggagccctgcttgtcctgcagc
tcggttgtaggggcccagcatcttgtgtcctccacaggggccagtggagatgtgggttcc
cctggctttggtctgcctggccttccgggtagagctggggttccagggctgaaaggagag
aagggtaacttcggggaggcagggccagctggcagtccagggccaccaggaccagtgggg
ccagcaggcatcaaaggggcgaagggggagccctgtgagccgtgcccagccctgtccaac
cttcaggatggggatgtccgtgtggtggccttgcctggcccatccggagagaagggggaa
cctgggcctccaggctttggcttgccaggaaaacagggcaaggctggagagcgtggactg
aaggggcagaagggtgatgctgggaatcctggagaccctggaacgccgggcaccacaggg
cggccaggactgtcaggagagcctggagttcagggccccgcggggccaaaaggagaaaag
ggtgatggctgcactgcctgccccagcctgcaggggacagtgacagacatggcaggacgg
cctgggcagcccggccccaaaggagagcagggccccgaaggcgtgggccgacctggtaaa
cccggccaacccggtctaccaggagttcaagggcccccaggactgaagggcgtgcaggga
gagccagggcctccaggaaggggagtccagggaccccagggggagcctggagccccgggt
ttgcctggcattcagggacttccgggacctcggggaccacctggccccactggagagaag
ggtgcccagggatctccaggggtgaaaggagccaccggacctgtgggacctcctggggcc
agtgtctctgggcctccgggccgtgatgggcagcaaggacagacgggactcagaggaaca
ccaggtgaaaaaggaccacgaggagagaagggtgagccaggggagtgctcctgcccctct
caaggagacctcatcttctctggcatgccgggtgctccgggactttggatgggcagctcc
tggcagccgggcccgcagggtccaccaggtattcccggaccaccaggcccccctggagta
cctgggctgcagggagtgcctggaaacaacggtttgccaggacagcctgggctcactgca
gaactgggatccttaccaattgaacagcacctccttaagagtatctgcggggactgtgtc
caggggcagagggcccacccagggtacctcgtggagaagggagagaagggagaccagggc
atccctggtgtgccaggcctcgacaactgcgcccagtgctttttgtcactggagcgccca
agagccgaggaggcccggggtgacaacagtgagggagatcctggctgtgttgggagccca
ggcctacctggtcctccgggattgccaggccagagaggagaagagggtccgcctggcatg
aggggctccccgggtcctccaggccctatcggccccccaggttttcctggtgctgttggc
tcccccggattgcctggccttcaaggagagcgaggtctcacgggcctgactggagacaag
ggggagccgggtcctccagggcaaccaggttacccaggtgccacgggccccccaggactg
cctggcatcaagggggagcgtggctacaccgggtcagcgggagagaaaggagagccgggc
cccccaggatctgaaggcctcccaggccccccaggcccagcgggtcccagaggagagcga
ggaccccaaggtaactccggtgagaagggcgaccagggatttcaaggccagccaggcttt
ccgggcccaccgggtccccctggattcccaggcaaagttggatcacctggcccacctggc
cctcaagcagagaagggcagcgaagggattcgaggcccatcaggcctgcctggctcccct
gggccaccgggacctcctgggattcagggccccgccggtctggatggtttggatgggaag
gacggcaagcctggcttgaggggggaccctggtcctgctggcccccctggactcatggga
ccaccgggctttaaggggaaaacaggacatcctggcctcccaggacctaagggtgactgt
ggcaaaccaggtccccctggcagcactggccggcctggcgcagagggtgaacctggtgcc
atgggaccccagggaagacccggtcccccgggacacgttgggccaccagggcctccaggc
cagccaggaccagctgggatctctgcagtgggtctgaaaggagaccgaggagccaccgga
gaaaggggccttgcaggcctcccaggccagcccggcccccctggacaccctggcccccca
ggcgaacctggtacggatggtgcagctggcaaagagggaccccctggaaagcagggattc
tatggacctcctggtcccaagggtgatccaggagctgcaggacagaagggccaggcagga
gagaaggggagagccggcatgcctggtggacctggcaagagtggttccatggggcctgtt
gggccaccgggccctgcaggagagagaggccaccctggagctccggggccttcggggagc
cctggcttgcctggtgtgcctggctccatgggagacatggtgaattatgatgaaatcaag
aggttcatcagacaagagatcattaaaatgtttgatgagagaatggcttactacacctcc
aggatgcagttccccatggagatggcggcagctccgggacgaccagggcctccagggaag
gatggtgctccgggcaggccaggtgctccagggtcacctgggctccctggtcagattggc
agagaaggacggcagggcttgccaggagtaagaggattgcctggtaccaaaggtgaaaaa
ggggacattggtattggcattgcaggagaaaatggtcttcccggccccccaggtcctcaa
ggtcctccaggctatggcaagatgggtgcaacaggaccaatgggccagcaaggcatccct
ggcatccctgggcccccgggtcccatgggccagccaggcaaggctggccactgtaatccc
tctgactgctttggggccatgccgatggagcagcagtacccacccatgaaaaccatgaag
gggccttttggctga

DBGET integrated database retrieval system