KEGG   Homo sapiens (human): 1308Help
Entry
1308              CDS       T01001                                 

Gene name
COL17A1, BA16H23.2, BP180, BPA-2, BPAG2, ERED, LAD-1
Definition
(RefSeq) collagen type XVII alpha 1 chain
  KO
K07603  collagen, type XVII, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Disease
H00586  Epidermolysis bullosa, junctional
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    1308 (COL17A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen DUF2868
Motif
Other DBs
NCBI-GeneID: 1308
NCBI-ProteinID: NP_000485
OMIM: 113811
HGNC: 2194
Ensembl: ENSG00000065618
Vega: OTTHUMG00000018998
Pharos: Q9UMD9(Tbio)
UniProt: Q9UMD9
Position
10q25.1
AA seq 1497 aa AA seqDB search
MDVTKKNKRDGTEVTERIVTETVTTRLTSLPPKGGTSNGYAKTASLGGGSRLEKQSLTHG
SSGYINSTGSTRGHASTSSYRRAHSPASTLPNSPGSTFERKTHVTRHAYEGSSSGNSSPE
YPRKEFASSSTRGRSQTRESEIRVRLQSASPSTRWTELDDVKRLLKGSRSASVSPTRNSS
NTLPIPKKGTVETKIVTASSQSVSGTYDATILDANLPSHVWSSTLPAGSSMGTYHNNMTT
QSSSLLNTNAYSAGSVFGVPNNMASCSPTLHPGLSTSSSVFGMQNNLAPSLTTLSHGTTT
TSTAYGVKKNMPQSPAAVNTGVSTSAACTTSVQSDDLLHKDCKFLILEKDNTPAKKEMEL
LIMTKDSGKVFTASPASIAATSFSEDTLKKEKQAAYNADSGLKAEANGDLKTVSTKGKTT
TADIHSYGSSGGGGSGGGGGVGGAGGGPWGPAPAWCPCGSCCSWWKWLLGLLLTWLLLLG
LLFGLIALAEEVRKLKARVDELERIRRSILPYGDSMDRIEKDRLQGMAPAAGADLDKIGL
HSDSQEELWMFVRKKLMMEQENGNLRGSPGPKGDMGSPGPKGDRGFPGTPGIPGPLGHPG
PQGPKGQKGSVGDPGMEGPMGQRGREGPMGPRGEAGPPGSGEKGERGAAGEPGPHGPPGV
PGSVGPKGSSGSPGPQGPPGPVGLQGLRGEVGLPGVKGDKGPMGPPGPKGDQGEKGPRGL
TGEPGMRGLPGAVGEPGAKGAMGPAGPDGHQGPRGEQGLTGMPGIRGPPGPSGDPGKPGL
TGPQGPQGLPGTPGRPGIKGEPGAPGKIVTSEGSSMLTVPGPPGPPGAMGPPGPPGAPGP
AGPAGLPGHQEVLNLQGPPGPPGPRGPPGPSIPGPPGPRGPPGEGLPGPPGPPGSFLSNS
ETFLSGPPGPPGPPGPKGDQGPPGPRGHQGEQGLPGFSTSGSSSFGLNLQGPPGPPGPQG
PKGDKGDPGVPGALGIPSGPSEGGSSSTMYVSGPPGPPGPPGPPGSISSSGQEIQQYISE
YMQSDSIRSYLSGVQGPPGPPGPPGPVTTITGETFDYSELASHVVSYLRTSGYGVSLFSS
SISSEDILAVLQRDDVRQYLRQYLMGPRGPPGPPGASGDGSLLSLDYAELSSRILSYMSS
SGISIGLPGPPGPPGLPGTSYEELLSLLRGSEFRGIVGPPGPPGPPGIPGNVWSSISVED
LSSYLHTAGLSFIPGPPGPPGPPGPRGPPGVSGALATYAAENSDSFRSELISYLTSPDVR
SFIVGPPGPPGPQGPPGDSRLLSTDASHSRGSSSSSHSSSVRRGSSYSSSMSTGGGGAGS
LGAGGAFGEAAGDRGPYGTDIGPGGGYGAAAEGGMYAGNGGLLGADFAGDLDYNELAVRV
SESMQRQGLLQGMAYTVQGPPGQPGPQGPPGISKVFSAYSNVTADLMDFFQTYGAIQGPP
GQKGEMGTPGPKGDRGPAGPPGHPGPPGPRGHKGEKGDKGDQVYAGRRRRRSIAVKP
NT seq 4494 nt NT seq  +upstreamnt  +downstreamnt
atggatgtaaccaagaaaaacaaacgagatggaactgaagtcactgagagaattgtcact
gaaacagtaaccacaagacttacatccttaccaccaaaaggcgggaccagcaatggctat
gctaaaacagcctctcttggtggagggagccggctggagaaacaaagcctgactcatggc
agcagcggctacataaactcaactggaagcacacgaggccatgcctccacctctagttac
aggagggctcactcacctgcctccactctgcccaactccccaggctcaacctttgaaagg
aaaactcacgttacccgccatgcgtatgaagggagctccagtggcaactcttctccggag
taccctcggaaggaatttgcatcttcttcaaccagaggacggagtcaaacacgagagagt
gaaattcgagttcgactgcagagtgcgtccccatccacccgatggacagaattggatgat
gttaagcgtttgctcaaggggagtcgatcggcaagtgtgagccccacccggaattcctcc
aacacactccccatccccaagaaaggcactgtggagaccaaaattgtgacagcgagctcc
cagtcggtgtcaggcacctacgatgcaacgatcctggatgccaaccttccctcccatgtg
tggtcctccaccctgcccgcggggtcctccatggggacctatcacaacaacatgacaacc
cagagctcatccctcctcaacaccaatgcctactctgcgggatcagtcttcggagttcca
aacaacatggcgtcctgctcacccactttgcaccctggactcagcacatcctcctcagtg
tttggcatgcagaacaatctggcccccagcttgaccaccctgtcccatggcaccaccacc
acttccacagcatatggggtgaagaaaaacatgccccagagtcctgcggctgtgaacact
ggcgtttccacctccgccgcctgcaccacaagtgtgcagagcgatgaccttttgcacaag
gactgcaagttcctgatcctagagaaagacaacacacctgccaagaaggagatggagctg
ctcatcatgaccaaggacagcgggaaggtctttacagcctcccctgccagcatcgctgca
acttctttttcagaagacaccctaaaaaaagaaaagcaagctgcctacaatgctgactca
ggcctaaaagccgaagctaatggagacctgaagactgtgtccacaaagggcaagaccacc
actgcagatatccacagctacggcagcagtggtggtggtggcagtggaggaggtggcggt
gttggtggcgctggcggcggcccttggggaccagcgccagcctggtgcccctgcggctcc
tgctgcagctggtggaagtggctgctgggcctgctgctcacctggctgctactcctgggg
ctgctcttcggcctcattgctctggcggaggaggtgaggaagctgaaggcgcgtgtggat
gagctggagaggatcaggaggagcatactgccctatggggacagcatggatagaatagaa
aaggaccgcctccagggcatggcacccgcggcgggagcagacctggacaaaattgggctg
cacagtgacagccaggaggagctctggatgttcgtgaggaagaagctaatgatggaacag
gaaaatggaaatctccgaggaagccctggccctaaaggtgacatgggaagtccaggccct
aaaggagatcgagggttccctgggactccaggtatccctgggcccttgggccacccaggt
ccacaaggaccaaagggtcaaaaaggcagcgtgggagatcctggcatggaaggccccatg
ggccagagagggcgagaaggccccatgggacctcgtggtgaggcagggcctcctggatct
ggagagaaaggggaaagaggggctgctggtgaaccaggtcctcatggcccacctggtgtc
ccaggttctgtgggtcccaaaggttccagcggctctcctggcccacagggccctccaggt
cctgtaggtctccaagggctccgaggtgaagtaggacttcctggtgtcaaaggtgacaaa
ggaccaatgggaccaccaggacccaaaggtgaccagggtgagaaaggacctcgaggcctc
acaggcgagcctggcatgagaggtttgcctggtgctgttggtgagcccggggctaaagga
gcaatgggtcctgctggcccagacggacaccaaggcccaagaggtgaacaaggtcttact
gggatgcctggaatccgtggcccaccaggaccttctggagacccaggaaagccaggtctc
acaggaccccagggacctcagggacttcccggtacccctggccgaccaggaataaaaggt
gaaccaggagctccaggcaagatcgtgacttcggaggggtcatcgatgctcactgtccca
ggccccccaggacctcctggagccatgggacccccaggacctccaggtgccccaggccct
gccggcccagctggtctcccaggacatcaagaagttcttaatttacaaggtcccccaggc
ccacccggcccacgcgggccaccagggccttccattccaggcccaccaggaccccgaggc
ccaccaggggagggtttgccaggcccaccaggcccaccaggatcgttcctgtccaactca
gaaaccttcctctccggccccccaggcccacctggccccccaggtcccaagggagaccaa
ggtcccccaggccccagaggacaccaaggcgagcaaggcctcccaggtttctcaacctca
gggtccagttctttcggactcaaccttcagggaccaccaggcccacctggcccccaggga
cccaaaggtgacaaaggtgatccaggtgttccaggggctcttggcattcctagtggtcct
tctgaagggggatcatcaagtaccatgtacgtgtcaggcccgccagggccccctgggccc
cctgggcctccgggctctatcagcagctctggccaggagattcagcagtacatctctgag
tacatgcagagtgacagtattagatcttacctatccggagttcagggtcccccaggccca
cctggtcccccaggacctgtcaccaccatcacaggcgagactttcgactactcagagctg
gcaagccacgttgtgagctacttacggacttcggggtacggtgtcagcttgttctcgtcc
tccatctcttctgaagacattctggctgtgctgcagcgggatgacgtgcgtcagtaccta
cgtcagtacttgatgggccctcggggtccgccagggccaccaggagccagtggagatggg
tccctcctgtctttggactatgcagagctgagtagtcgcattctcagctacatgtcgagt
tctgggatcagcattgggcttcctggtcccccggggccccctggcttgccgggaacctcc
tatgaggagctcctctccttgctgcgagggtctgaattcagaggcatcgttggaccccca
ggtcccccgggtccaccagggatcccaggcaatgtgtggtccagcatcagcgtggaggac
ctctcgtcttacttacatactgccggcttgtcattcatcccaggccctccaggacctcct
ggtcccccagggcctcgagggcccccgggtgtctcaggagccctggcaacctatgcagct
gaaaacagcgacagcttccggagcgagctgatcagctacctcacaagtcctgatgtgcgc
agcttcattgttggccccccaggccctcctgggccgcagggaccccctggggacagccgc
ctcctgtccacggatgcctcccacagtcggggtagcagctcctcctcacacagctcatct
gtcaggcggggcagctcctacagctcttccatgagcacaggaggaggtggtgcaggctcc
ctgggtgcaggcggtgcctttggtgaagctgcaggagacaggggtccctatggcactgac
atcggcccaggcggaggctatggggcagcagcagaaggcggcatgtatgctggcaatggc
ggactattgggagctgactttgctggagatctggattacaatgagctggctgtgagggtg
tcagagagcatgcagcgtcagggcctactgcaagggatggcctacactgtccagggccca
ccaggccagcctgggccacaggggccacccggcatcagcaaggtcttctctgcctacagc
aacgtgactgcggacctcatggacttcttccaaacttatggagccattcaaggaccccct
gggcaaaaaggagagatgggcactccaggacccaaaggtgacaggggccctgctgggcca
ccaggtcatcctgggccacctggccctcgaggacacaagggagaaaaaggagacaaaggt
gaccaagtctatgctgggcggagaaggagaagaagtattgctgtcaagccgtga

DBGET integrated database retrieval system