KEGG   Homo sapiens (human): 131Help
Entry
131               CDS       T01001                                 

Gene name
ADH7, ADH4
Definition
(RefSeq) alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00071  Fatty acid degradation
hsa00350  Tyrosine metabolism
hsa00830  Retinol metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    131 (ADH7)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    131 (ADH7)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    131 (ADH7)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    131 (ADH7)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    131 (ADH7)
   00982 Drug metabolism - cytochrome P450
    131 (ADH7)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    131 (ADH7)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     131 (ADH7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C
Motif
Other DBs
NCBI-GeneID: 131
NCBI-ProteinID: NP_000664
OMIM: 600086
HGNC: 256
Ensembl: ENSG00000196344
Vega: OTTHUMG00000159318
Pharos: P40394(Tchem)
UniProt: P40394
Structure
PDB: 

Position
4q23
AA seq 386 aa AA seqDB search
MFAEIQIQDKDRMGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICR
TDDHVIKGTMVSKFPVIVGHEATGIVESIGEGVTTVKPGDKVIPLFLPQCRECNACRNPD
GNLCIRSDITGRGVLADGTTRFTCKGKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEK
VCLIGCGFSTGYGAAVKTGKVKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGIDLNKDK
FEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGT
SVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLITH
VLPFKKISEGFELLNSGQSIRTVLTF
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcagaaatacagatccaagacaaagacaggatgggcactgctggaaaagttatt
aaatgcaaagcagctgtgctttgggagcagaagcaacccttctccattgaggaaatagaa
gttgccccaccaaagactaaagaagttcgcattaagattttggccacaggaatctgtcgc
acagatgaccatgtgataaaaggaacaatggtgtccaagtttccagtgattgtgggacat
gaggcaactgggattgtagagagcattggagaaggagtgactacagtgaaaccaggtgac
aaagtcatccctctctttctgccacaatgtagagaatgcaatgcttgtcgcaacccagat
ggcaacctttgcattaggagcgatattactggtcgtggagtactggctgatggcaccacc
agatttacatgcaagggcaaaccagtccaccacttcatgaacaccagtacatttaccgag
tacacagtggtggatgaatcttctgttgctaagattgatgatgcagctcctcctgagaaa
gtctgtttaattggctgtgggttttccactggatatggcgctgctgttaaaactggcaag
gtcaaacctggttccacttgcgtcgtctttggcctgggaggagttggcctgtcagtcatc
atgggctgtaagtcagctggtgcatctaggatcattgggattgacctcaacaaagacaaa
tttgagaaggccatggctgtaggtgccactgagtgtatcagtcccaaggactctaccaaa
cccatcagtgaggtgctgtcagaaatgacaggcaacaacgtgggatacacctttgaagtt
attgggcatcttgaaaccatgattgatgccctggcatcctgccacatgaactatgggacc
agcgtggttgtaggagttcctccatcagccaagatgctcacctatgacccgatgttgctc
ttcactggacgcacatggaagggatgtgtctttggaggtttgaaaagcagagatgatgtc
ccaaaactagtgactgagttcctggcaaagaaatttgacctggaccagttgataactcat
gttttaccatttaaaaaaatcagtgaaggatttgagctgctcaattcaggacaaagcatt
cgaacggtcctgacgttttga

DBGET integrated database retrieval system