KEGG   Homo sapiens (human): 1311
Entry
1311              CDS       T01001                                 
Symbol
COMP, CTS2, EDM1, EPD1, MED, PSACH, THBS5, TSP5
Name
(RefSeq) cartilage oligomeric matrix protein
  KO
K04659  thrombospondin 2/3/4/5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05144  Malaria
hsa05165  Human papillomavirus infection
Disease
H00476  Multiple epiphyseal dysplasia
H00477  Pseudoachondroplasia
H00798  Familial carpal tunnel syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    1311 (COMP)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    1311 (COMP)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    1311 (COMP)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    1311 (COMP)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    1311 (COMP)
  09174 Infectious disease: parasitic
   05144 Malaria
    1311 (COMP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1311 (COMP)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1311 (COMP)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1311 (COMP)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    1311 (COMP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1311 (COMP)
  Exosomal proteins of colorectal cancer cells
   1311 (COMP)
  Exosomal proteins of bladder cancer cells
   1311 (COMP)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   1311 (COMP)
SSDB
Motif
Pfam: TSP_C TSP_3 EGF_CA EGF_3 COMP cEGF EGF_MSP1_1 EGF hEGF
Other DBs
NCBI-GeneID: 1311
NCBI-ProteinID: NP_000086
OMIM: 600310
HGNC: 2227
Ensembl: ENSG00000105664
Pharos: P49747(Tbio)
UniProt: P49747
Structure
Position
19:complement(18782773..18791305)
AA seq 757 aa
MVPDTACVLLLTLAALGASGQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREIT
FLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTG
NGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHQGVGLAFAKANKQVCTD
INECETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQASGCQRRAQRFCPDGSPSECHEH
ADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSGQ
EDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQK
DTDQDGRGDACDDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQAD
VDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDS
RDNCRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLD
PEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFI
FGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDT
ESQVRLLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGG
RLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRQA
NT seq 2274 nt   +upstreamnt  +downstreamnt
atggtccccgacaccgcctgcgttcttctgctcaccctggctgccctcggcgcgtccgga
cagggccagagcccgttgggctcagacctgggcccgcagatgcttcgggaactgcaggaa
accaacgcggcgctgcaggacgtgcgggagctgctgcggcagcaggtcagggagatcacg
ttcctgaaaaacacggtgatggagtgtgacgcgtgcgggatgcagcagtcagtacgcacc
ggcctacccagcgtgcggcccctgctccactgcgcgcccggcttctgcttccccggcgtg
gcctgcatccagacggagagcggcgcgcgctgcggcccctgccccgcgggcttcacgggc
aacggctcgcactgcaccgacgtcaacgagtgcaacgcccacccctgcttcccccgagtc
cgctgtatcaacaccagcccggggttccgctgcgaggcttgcccgccggggtacagcggc
cccacccaccagggcgtggggctggctttcgccaaggccaacaagcaggtttgcacggac
atcaacgagtgtgagaccgggcaacataactgcgtccccaactccgtgtgcatcaacacc
cggggctccttccagtgcggcccgtgccagcccggcttcgtgggcgaccaggcgtccggc
tgccagcggcgcgcacagcgcttctgccccgacggctcgcccagcgagtgccacgagcat
gcagactgcgtcctagagcgcgatggctcgcggtcgtgcgtgtgtgccgttggctgggcc
ggcaacgggatcctctgtggtcgcgacactgacctagacggcttcccggacgagaagctg
cgctgcccggagcgccagtgccgtaaggacaactgcgtgactgtgcccaactcagggcag
gaggatgtggaccgcgatggcatcggagacgcctgcgatccggatgccgacggggacggg
gtccccaatgaaaaggacaactgcccgctggtgcggaacccagaccagcgcaacacggac
gaggacaagtggggcgatgcgtgcgacaactgccggtcccagaagaacgacgaccaaaag
gacacagaccaggacggccggggcgatgcgtgcgacgacgacatcgacggcgaccggatc
cgcaaccaggccgacaactgccctagggtacccaactcagaccagaaggacagtgatggc
gatggtataggggatgcctgtgacaactgtccccagaagagcaacccggatcaggcggat
gtggaccacgactttgtgggagatgcttgtgacagcgatcaagaccaggatggagacgga
catcaggactctcgggacaactgtcccacggtgcctaacagtgcccaggaggactcagac
cacgatggccagggtgatgcctgcgacgacgacgacgacaatgacggagtccctgacagt
cgggacaactgccgcctggtgcctaaccccggccaggaggacgcggacagggacggcgtg
ggcgacgtgtgccaggacgactttgatgcagacaaggtggtagacaagatcgacgtgtgt
ccggagaacgctgaagtcacgctcaccgacttcagggccttccagacagtcgtgctggac
ccggagggtgacgcgcagattgaccccaactgggtggtgctcaaccagggaagggagatc
gtgcagacaatgaacagcgacccaggcctggctgtgggttacactgccttcaatggcgtg
gacttcgagggcacgttccatgtgaacacggtcacggatgacgactatgcgggcttcatc
tttggctaccaggacagctccagcttctacgtggtcatgtggaagcagatggagcaaacg
tattggcaggcgaaccccttccgtgctgtggccgagcctggcatccaactcaaggctgtg
aagtcttccacaggccccggggaacagctgcggaacgctctgtggcatacaggagacaca
gagtcccaggtgcggctgctgtggaaggacccgcgaaacgtgggttggaaggacaagaag
tcctatcgttggttcctgcagcaccggccccaagtgggctacatcagggtgcgattctat
gagggccctgagctggtggccgacagcaacgtggtcttggacacaaccatgcggggtggc
cgcctgggggtcttctgcttctcccaggagaacatcatctgggccaacctgcgttaccgc
tgcaatgacaccatcccagaggactatgagacccatcagctgcggcaagcctag

DBGET integrated database retrieval system