KEGG   Homo sapiens (human): 1312Help
Entry
1312              CDS       T01001                                 

Gene name
COMT, HEL-S-98n
Definition
(RefSeq) catechol-O-methyltransferase
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa00350  Tyrosine metabolism
hsa01100  Metabolic pathways
hsa04728  Dopaminergic synapse
Disease
H01450  Obsessive-compulsive disorder (OCD)
Drug target
Entacapone: D00781
Flopropione: D01259
Nitecapone: D03241
Opicapone: D10825
Phloroglucinol (DG00050): D00152 D08369
Tolcapone: D00786
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    1312 (COMT)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    1312 (COMT)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    1312 (COMT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1312 (COMT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     1312 (COMT)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   1312 (COMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 Methyltransf_15 CmcI PCMT Methyltransf_31
Motif
Other DBs
NCBI-GeneID: 1312
NCBI-ProteinID: NP_000745
OMIM: 116790
HGNC: 2228
Ensembl: ENSG00000093010
Vega: OTTHUMG00000150529
Pharos: P21964(Tclin)
UniProt: P21964 A0A140VJG8
Structure
PDB: 

Position
22q11.21
AA seq 271 aa AA seqDB search
MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRIL
NHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCG
YSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKY
DVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFE
CTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggccccgcctctgctgttggcagctgtgttgctgggcctggtgctgctggtg
gtgctgctgctgcttctgaggcactggggctggggcctgtgccttatcggctggaacgag
ttcatcctgcagcccatccacaacctgctcatgggtgacaccaaggagcagcgcatcctg
aaccacgtgctgcagcatgcggagcccgggaacgcacagagcgtgctggaggccattgac
acctactgcgagcagaaggagtgggccatgaacgtgggcgacaagaaaggcaagatcgtg
gacgccgtgattcaggagcaccagccctccgtgctgctggagctgggggcctactgtggc
tactcagctgtgcgcatggcccgcctgctgtcaccaggggcgaggctcatcaccatcgag
atcaaccccgactgtgccgccatcacccagcggatggtggatttcgctggcgtgaaggac
aaggtcacccttgtggttggagcgtcccaggacatcatcccccagctgaagaagaagtat
gatgtggacacactggacatggtcttcctcgaccactggaaggaccggtacctgccggac
acgcttctcttggaggaatgtggcctgctgcggaaggggacagtgctactggctgacaac
gtgatctgcccaggtgcgccagacttcctagcacacgtgcgcgggagcagctgctttgag
tgcacacactaccaatcgttcctggaatacagggaggtggtggacggcctggagaaggcc
atctacaagggcccaggcagcgaagcagggccctga

DBGET integrated database retrieval system