KEGG   Homo sapiens (human): 131368
Entry
131368            CDS       T01001                                 

Gene name
ZPLD1
Definition
(RefSeq) zona pellucida like domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Zona_pellucida
Other DBs
NCBI-GeneID: 131368
NCBI-ProteinID: NP_001316717
OMIM: 615915
HGNC: 27022
Ensembl: ENSG00000170044
Vega: OTTHUMG00000159229
Pharos: Q8TCW7(Tbio)
UniProt: Q8TCW7
Position
3q12.3
AA seq 415 aa
MEQIWLLLLLTIRVLPGSAQFNGYNCDANLHSRFPAERDISVYCGVQAITMKINFCTVLF
SGYSETDLALNGRHGDSHCRGFINNNTFPAVVIFIINLSTLEGCGNNLVVSTIPGVSAYG
NATSVQVGNISGYIDTPDPPTIISYLPGLLYKFSCSYPLEYLVNNTQLASSSAAISVREN
NGTFVSTLNLLLYNDSTYNQQLIIPSIGLPLKTKVFAAVQATNLDGRWNVLMDYCYTTPS
GNPNDDIRYDLFLSCDKDPQTTVIENGRSQRGRFSFEVFRFVKHKNQKMSTVFLHCVTKL
CRADDCPFLMPICSHRERRDAGRRTTWSPQSSSGSAVLSAGPIITRSDETPTNNSQLGSP
SMPPFQLNAITSALISGMVILGVTSFSLLLCSLALLHRKGPTSLVLNGIRNPVFD
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggaacaaatatggttgctgctgcttctaacaattagagtgcttccggggtctgctcag
ttcaacggctacaactgtgatgccaacctccacagtagatttcctgctgaaagagacatc
agtgtctattgtggagtgcaggctattacgatgaagattaatttttgcacggtacttttc
tcgggttattcggaaacagatctggcactgaatggaaggcatggggactcccactgcaga
gggttcatcaataacaacacctttccagcagtggtcatttttatcatcaatctcagcacc
ttggagggctgtggaaacaacctggtggtatccacaattcctggagtcagtgcttatgga
aatgcaacttcagtgcaagtaggaaatatttcaggatatattgatactccagacccacca
acaatcatcagctatctacctgggcttctttacaaatttagttgtagttatccattggaa
tacctggttaataatacccagcttgcttcgtcctcagcggctatttctgtgagagagaac
aatggcacatttgtcagcactttgaacctgctcctttataacgattcaacctacaaccag
cagttaattatccccagtataggattacctttgaaaaccaaagtatttgcagctgtccaa
gccactaatttggatggcagatggaatgttttaatggattattgctatactaccccatca
ggaaacccaaatgatgacattcgatatgatcttttccttagctgtgacaaggaccctcag
accaccgtcattgagaatggccgaagccagcggggccggttttcttttgaagtgttccga
tttgtgaaacacaagaatcagaaaatgtccactgtcttcttgcactgcgttaccaagctc
tgcagagcagatgactgccccttccttatgccgatttgcagccacagagaaaggagagat
gctgggaggaggacgacttggagcccccagagctcttctggcagcgcggtgctctctgct
ggtcccatcattactcggagtgatgagactccaaccaacaattcgcaacttggttctcca
agtatgcctcccttccagctgaacgccatcaccagcgcactgatatcaggaatggtcatt
ctgggagttacgagcttttctcttcttctgtgctcactggcccttctgcacaggaaggga
cccacaagtttagtgttgaatggcataagaaacccagtctttgactga

DBGET integrated database retrieval system