KEGG   Homo sapiens (human): 131375Help
Entry
131375            CDS       T01001                                 

Gene name
LYZL4, LYC4, LYZA
Definition
(RefSeq) lysozyme like 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Lys SLT
Motif
Other DBs
NCBI-GeneID: 131375
NCBI-ProteinID: NP_001291315
OMIM: 612750
HGNC: 28387
Ensembl: ENSG00000157093
Vega: OTTHUMG00000131793
Pharos: Q96KX0(Tdark)
UniProt: Q96KX0 A0A080YUZ5
Position
3p22.1
AA seq 146 aa AA seqDB search
MKASVVLSLLGYLVVPSGAYILGRCTVAKKLHDGGLDYFEGYSLENWVCLAYFESKFNPM
AIYENTREGYTGFGLFQMRGSDWCGDHGRNRCHMSCSALLNPNLEKTIKCAKTIVKGKEG
MGAWPTWSRYCQYSDTLARWLDGCKL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcatccgtggttctctccctccttggctacctggtggttccaagtggtgcttac
atcttggggcgttgcacagtggctaagaaactccacgatggaggcctggattattttgag
ggctatagccttgagaactgggtgtgcctggcctacttcgagagcaagttcaaccccatg
gccatctacgagaacacacgtgagggctacactggctttggcctctttcagatgcgtggc
agtgactggtgtggcgaccatggcaggaaccgctgccatatgtcatgttccgctttactg
aatcctaatttagagaagacaattaaatgtgccaagaccattgtaaaaggaaaagaaggg
atgggagcatggcccacctggtcccggtactgccagtactccgataccctggcacggtgg
ctggatggttgcaagctgtag

DBGET integrated database retrieval system