KEGG   Homo sapiens (human): 1314
Entry
1314              CDS       T01001                                 
Symbol
COPA, AILJK, HEP-COP, alpha-COP
Name
(RefSeq) COPI coat complex subunit alpha
  KO
K05236  coatomer subunit alpha
Organism
hsa  Homo sapiens (human)
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01293  COPI vesicle formation
Disease
H01232  Syndromic multisystem autoimmune disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1314 (COPA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1314 (COPA)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    1314 (COPA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1314 (COPA)
  Exosomal proteins of bladder cancer cells
   1314 (COPA)
SSDB
Motif
Pfam: COPI_C Coatomer_WDAD WD40 ANAPC4_WD40 NBCH_WD40 TPR_14
Other DBs
NCBI-GeneID: 1314
NCBI-ProteinID: NP_004362
OMIM: 601924
HGNC: 2230
Ensembl: ENSG00000122218
Pharos: P53621(Tbio)
UniProt: P53621
Structure
Position
1:complement(160288594..160343250)
AA seq 1224 aa
MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH
KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW
NWQSRTCVCVLTGHNHYVMCAQFHPTEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD
VRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAW
EVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAH
PNLNLFAAGHDGGMIVFKLERERPAYAVHGNMLHYVKDRFLRQLDFNSSKDVAVMQLRSG
SKFPVFNMSYNPAENAVLLCTRASNLENSTYDLYTIPKDADSQNPDAPEGKRSSGLTAVW
VARNRFAVLDRMHSLLIKNLKNEITKKVQVPNCDEIFYAGTGNLLLRDADSITLFDVQQK
RTLASVKISKVKYVIWSADMSHVALLAKHAIVICNRKLDALCNIHENIRVKSGAWDESGV
FIYTTSNHIKYAVTTGDHGIIRTLDLPIYVTRVKGNNVYCLDRECRPRVLTIDPTEFKFK
LALINRKYDEVLHMVRNAKLVGQSIIAYLQKKGYPEVALHFVKDEKTRFSLALECGNIEI
ALEAAKALDDKNCWEKLGEVALLQGNHQIVEMCYQRTKNFDKLSFLYLITGNLEKLRKMM
KIAEIRKDMSGHYQNALYLGDVSERVRILKNCGQKSLAYLTAATHGLDEEAESLKETFDP
EKETIPDIDPNAKLLQPPAPIMPLDTNWPLLTVSKGFFEGTIASKGKGGALAADIDIDTV
GTEGWGEDAELQLDEDGFVEATEGLGDDALGKGQEEGGGWDVEEDLELPPELDISPGAAG
GAEDGFFVPPTKGTSPTQIWCNNSQLPVDHILAGSFETAMRLLHDQVGVIQFGPYKQLFL
QTYARGRTTYQALPCLPSMYGYPNRNWKDAGLKNGVPAVGLKLNDLIQRLQLCYQLTTVG
KFEEAVEKFRSILLSVPLLVVDNKQEIAEAQQLITICREYIVGLSVETERKKLPKETLEQ
QKRICEMAAYFTHSNLQPVHMILVLRTALNLFFKLKNFKTAATFARRLLELGPKPEVAQQ
TRKILSACEKNPTDAYQLNYDMHNPFDICAASYRPIYRGKPVEKCPLSGACYSPEFKGQI
CRVTTVTEIGKDVIGLRISPLQFR
NT seq 3675 nt   +upstreamnt  +downstreamnt
atgttaaccaaattcgagaccaagagcgcgcgggtcaaagggctcagctttcaccccaaa
agaccttggatcctgactagtttacataatggggtcatccagttatgggactatcggatg
tgcactctcattgacaagtttgatgaacatgatggtccagtgcgaggcattgacttccat
aagcagcagccactgttcgtctctggaggagatgactataagattaaggtttggaattac
aagcttcggcgctgtcttttcacattgcttgggcacttagattatattcgcaccacgttt
tttcatcatgaatatccctggattctgagtgcctccgatgatcagaccatccgagtgtgg
aactggcaatctagaacctgtgtttgtgtgttaacagggcacaaccattatgtgatgtgt
gctcagttccaccccacagaagacttggtagtatcagccagcctggaccagactgtgcgc
gtttgggatatttctggtctgaggaaaaaaaacctgtcccctggtgcggtggaatcggat
gtgagaggaataactggggttgatctatttggaactacagatgcagtggtgaagcatgta
ctagagggtcacgatcgtggagtaaactgggctgccttccaccccactatgccccttatt
gtatctggggcagatgatcgtcaagtgaagatctggcgcatgaatgaatcaaaggcatgg
gaggttgatacctgccggggccattacaacaatgtatcttgtgccgtcttccaccctcgc
caagagttgatcctcagcaattctgaggacaagagtattcgagtctgggatatgtctaag
cggactggggttcagactttccgcagagaccatgatcgtttctgggtcctagctgctcac
cctaaccttaacctctttgcagcaggccatgatggtggtatgattgtgtttaagctggaa
cgggaacggccagcctatgctgttcatggcaatatgctacactatgtcaaggaccgattc
ttacgacagctggatttcaacagctccaaagatgtagctgtgatgcagttgcggagtggt
tccaagtttccagtattcaatatgtcatacaatccagcagaaaatgcagtcctgctttgt
acaagagctagcaatctagagaatagtacctatgacctgtacaccatccctaaagatgct
gactcccagaatcctgatgcgcctgaagggaaacgatcctcaggcctgacagccgtttgg
gtcgctcgaaatcggtttgctgtcctagatcggatgcattcgcttctgatcaagaatctg
aagaatgagatcaccaaaaaggtacaggtgcccaactgtgatgagatcttctatgctggc
acaggcaatctcctgcttcgagatgcggactctatcacactctttgacgtacagcagaag
cggactctggcatctgtgaagatttctaaagtgaaatacgttatctggtcagcagacatg
tcacatgtagcactactagccaaacacgccattgtgatctgtaaccgcaaactggatgct
ttatgtaacattcatgagaacattcgtgtcaagagtggggcctgggatgagagtggggta
tttatctataccacaagcaaccacatcaaatatgctgtcaccactggggaccacgggatc
attcgaactctggatttacccatctatgtcacacgggtgaagggcaacaatgtatactgc
ctagacagggagtgtcgtccccgggtactcaccattgatcccactgagttcaaattcaag
ctggccctgatcaacagaaaatatgatgaggtactgcacatggtgaggaatgccaaacta
gttggccagtctattattgcttatctccagaagaagggctatcctgaagtggcactgcat
tttgtcaaggatgagaaaactcgctttagtctggcactggagtgtggaaacattgagatt
gctctggaagcagccaaagcactggatgacaagaactgctgggaaaagctgggagaagtg
gccctgctgcaggggaaccaccagattgtggaaatgtgctatcagcgtaccaaaaacttt
gacaaactttccttcctgtatcttatcactggcaacttagaaaaacttcgcaagatgatg
aagattgctgagatcagaaaggacatgagtggccactatcagaatgccctatacctgggt
gatgtgtcagagcgtgtgcggatcctgaagaactgtggacagaagtccctggcctatctc
acagctgctacccatggcttagatgaagaagctgagagcctaaaggagacatttgaccca
gagaaggagacaatcccagacattgaccctaatgccaagctgctccagccacctgcacct
atcatgccattggataccaattggcctttattgactgtatccaaaggattttttgaaggc
accattgccagcaaagggaagggaggagcactggctgctgacattgacattgacactgtt
ggtacagagggctggggagaggatgcagagctgcagttggatgaagatgggtttgtggag
gctacagaaggtttgggggatgatgctcttggcaagggacaggaagaaggaggtggctgg
gatgtagaagaagatctggagctccctcctgagctggatatatcccctggggcagctggt
ggggctgaagatggtttctttgtgcccccaaccaagggaacaagtccaactcagatctgg
tgtaataactctcagcttccagttgatcacatcctggcaggctctttcgaaacagccatg
cggctccttcatgaccaagtaggggtaatccagtttggcccctacaagcaactgttccta
cagacatacgcccgaggccgcacaacctatcaggctctgccctgcctaccctccatgtat
ggctatcctaatcgcaactggaaggatgcagggctgaagaatggtgtaccagctgtgggc
ctgaagcttaatgacctcatccaacggttgcagctgtgctaccagctcaccacagttggc
aaatttgaggaggctgtggaaaaattccgttccatccttctcagtgtgccacttcttgtt
gtggacaataaacaagagattgcagaggcccagcagctcatcaccatttgccgtgagtac
attgtgggtttgtccgtggagacagaaaggaagaagctgcccaaagagactctagaacag
cagaagcgcatctgtgagatggcagcctatttcacccactcaaacctgcagcctgtgcac
atgatcctggtgctgcgtacagccctcaatctgttcttcaagctcaagaacttcaagaca
gctgccacctttgctcggcgcctactagaactcgggcccaagcctgaggtggcccaacag
acccgaaaaatcctgtctgcctgtgagaagaatcccacagatgcctaccagctcaattat
gacatgcacaacccctttgacatttgtgctgcatcatatcggcccatctaccgtggaaag
ccagtagaaaagtgtccactcagtggggcctgctattcccctgagttcaaaggtcaaatc
tgcagggtcaccacagtgacagagattggcaaagatgtgattggtttaaggatcagtcct
ctgcagtttcgctaa

DBGET integrated database retrieval system