KEGG   Homo sapiens (human): 1314Help
Entry
1314              CDS       T01001                                 

Gene name
COPA, AILJK, HEP-COP
Definition
(RefSeq) coatomer protein complex subunit alpha
  KO
K05236  coatomer subunit alpha
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1314 (COPA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1314 (COPA)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    1314 (COPA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1314 (COPA)
  Exosomal proteins of bladder cancer cells
   1314 (COPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COPI_C Coatomer_WDAD WD40 ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 1314
NCBI-ProteinID: NP_004362
OMIM: 601924
HGNC: 2230
Ensembl: ENSG00000122218
Vega: OTTHUMG00000033111
Pharos: P53621(Tbio)
UniProt: P53621
Position
1q23.2
AA seq 1224 aa AA seqDB search
MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH
KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW
NWQSRTCVCVLTGHNHYVMCAQFHPTEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD
VRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAW
EVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAH
PNLNLFAAGHDGGMIVFKLERERPAYAVHGNMLHYVKDRFLRQLDFNSSKDVAVMQLRSG
SKFPVFNMSYNPAENAVLLCTRASNLENSTYDLYTIPKDADSQNPDAPEGKRSSGLTAVW
VARNRFAVLDRMHSLLIKNLKNEITKKVQVPNCDEIFYAGTGNLLLRDADSITLFDVQQK
RTLASVKISKVKYVIWSADMSHVALLAKHAIVICNRKLDALCNIHENIRVKSGAWDESGV
FIYTTSNHIKYAVTTGDHGIIRTLDLPIYVTRVKGNNVYCLDRECRPRVLTIDPTEFKFK
LALINRKYDEVLHMVRNAKLVGQSIIAYLQKKGYPEVALHFVKDEKTRFSLALECGNIEI
ALEAAKALDDKNCWEKLGEVALLQGNHQIVEMCYQRTKNFDKLSFLYLITGNLEKLRKMM
KIAEIRKDMSGHYQNALYLGDVSERVRILKNCGQKSLAYLTAATHGLDEEAESLKETFDP
EKETIPDIDPNAKLLQPPAPIMPLDTNWPLLTVSKGFFEGTIASKGKGGALAADIDIDTV
GTEGWGEDAELQLDEDGFVEATEGLGDDALGKGQEEGGGWDVEEDLELPPELDISPGAAG
GAEDGFFVPPTKGTSPTQIWCNNSQLPVDHILAGSFETAMRLLHDQVGVIQFGPYKQLFL
QTYARGRTTYQALPCLPSMYGYPNRNWKDAGLKNGVPAVGLKLNDLIQRLQLCYQLTTVG
KFEEAVEKFRSILLSVPLLVVDNKQEIAEAQQLITICREYIVGLSVETERKKLPKETLEQ
QKRICEMAAYFTHSNLQPVHMILVLRTALNLFFKLKNFKTAATFARRLLELGPKPEVAQQ
TRKILSACEKNPTDAYQLNYDMHNPFDICAASYRPIYRGKPVEKCPLSGACYSPEFKGQI
CRVTTVTEIGKDVIGLRISPLQFR
NT seq 3675 nt NT seq  +upstreamnt  +downstreamnt
atgttaaccaaattcgagaccaagagcgcgcgggtcaaagggctcagctttcaccccaaa
agaccttggatcctgactagtttacataatggggtcatccagttatgggactatcggatg
tgcactctcattgacaagtttgatgaacatgatggtccagtgcgaggcattgacttccat
aagcagcagccactgttcgtctctggaggagatgactataagattaaggtttggaattac
aagcttcggcgctgtcttttcacattgcttgggcacttagattatattcgcaccacgttt
tttcatcatgaatatccctggattctgagtgcctccgatgatcagaccatccgagtgtgg
aactggcaatctagaacctgtgtttgtgtgttaacagggcacaaccattatgtgatgtgt
gctcagttccaccccacagaagacttggtagtatcagccagcctggaccagactgtgcgc
gtttgggatatttctggtctgaggaaaaaaaacctgtcccctggtgcggtggaatcggat
gtgagaggaataactggggttgatctatttggaactacagatgcagtggtgaagcatgta
ctagagggtcacgatcgtggagtaaactgggctgccttccaccccactatgccccttatt
gtatctggggcagatgatcgtcaagtgaagatctggcgcatgaatgaatcaaaggcatgg
gaggttgatacctgccggggccattacaacaatgtatcttgtgccgtcttccaccctcgc
caagagttgatcctcagcaattctgaggacaagagtattcgagtctgggatatgtctaag
cggactggggttcagactttccgcagagaccatgatcgtttctgggtcctagctgctcac
cctaaccttaacctctttgcagcaggccatgatggtggtatgattgtgtttaagctggaa
cgggaacggccagcctatgctgttcatggcaatatgctacactatgtcaaggaccgattc
ttacgacagctggatttcaacagctccaaagatgtagctgtgatgcagttgcggagtggt
tccaagtttccagtattcaatatgtcatacaatccagcagaaaatgcagtcctgctttgt
acaagagctagcaatctagagaatagtacctatgacctgtacaccatccctaaagatgct
gactcccagaatcctgatgcgcctgaagggaaacgatcctcaggcctgacagccgtttgg
gtcgctcgaaatcggtttgctgtcctagatcggatgcattcgcttctgatcaagaatctg
aagaatgagatcaccaaaaaggtacaggtgcccaactgtgatgagatcttctatgctggc
acaggcaatctcctgcttcgagatgcggactctatcacactctttgacgtacagcagaag
cggactctggcatctgtgaagatttctaaagtgaaatacgttatctggtcagcagacatg
tcacatgtagcactactagccaaacacgccattgtgatctgtaaccgcaaactggatgct
ttatgtaacattcatgagaacattcgtgtcaagagtggggcctgggatgagagtggggta
tttatctataccacaagcaaccacatcaaatatgctgtcaccactggggaccacgggatc
attcgaactctggatttacccatctatgtcacacgggtgaagggcaacaatgtatactgc
ctagacagggagtgtcgtccccgggtactcaccattgatcccactgagttcaaattcaag
ctggccctgatcaacagaaaatatgatgaggtactgcacatggtgaggaatgccaaacta
gttggccagtctattattgcttatctccagaagaagggctatcctgaagtggcactgcat
tttgtcaaggatgagaaaactcgctttagtctggcactggagtgtggaaacattgagatt
gctctggaagcagccaaagcactggatgacaagaactgctgggaaaagctgggagaagtg
gccctgctgcaggggaaccaccagattgtggaaatgtgctatcagcgtaccaaaaacttt
gacaaactttccttcctgtatcttatcactggcaacttagaaaaacttcgcaagatgatg
aagattgctgagatcagaaaggacatgagtggccactatcagaatgccctatacctgggt
gatgtgtcagagcgtgtgcggatcctgaagaactgtggacagaagtccctggcctatctc
acagctgctacccatggcttagatgaagaagctgagagcctaaaggagacatttgaccca
gagaaggagacaatcccagacattgaccctaatgccaagctgctccagccacctgcacct
atcatgccattggataccaattggcctttattgactgtatccaaaggattttttgaaggc
accattgccagcaaagggaagggaggagcactggctgctgacattgacattgacactgtt
ggtacagagggctggggagaggatgcagagctgcagttggatgaagatgggtttgtggag
gctacagaaggtttgggggatgatgctcttggcaagggacaggaagaaggaggtggctgg
gatgtagaagaagatctggagctccctcctgagctggatatatcccctggggcagctggt
ggggctgaagatggtttctttgtgcccccaaccaagggaacaagtccaactcagatctgg
tgtaataactctcagcttccagttgatcacatcctggcaggctctttcgaaacagccatg
cggctccttcatgaccaagtaggggtaatccagtttggcccctacaagcaactgttccta
cagacatacgcccgaggccgcacaacctatcaggctctgccctgcctaccctccatgtat
ggctatcctaatcgcaactggaaggatgcagggctgaagaatggtgtaccagctgtgggc
ctgaagcttaatgacctcatccaacggttgcagctgtgctaccagctcaccacagttggc
aaatttgaggaggctgtggaaaaattccgttccatccttctcagtgtgccacttcttgtt
gtggacaataaacaagagattgcagaggcccagcagctcatcaccatttgccgtgagtac
attgtgggtttgtccgtggagacagaaaggaagaagctgcccaaagagactctagaacag
cagaagcgcatctgtgagatggcagcctatttcacccactcaaacctgcagcctgtgcac
atgatcctggtgctgcgtacagccctcaatctgttcttcaagctcaagaacttcaagaca
gctgccacctttgctcggcgcctactagaactcgggcccaagcctgaggtggcccaacag
acccgaaaaatcctgtctgcctgtgagaagaatcccacagatgcctaccagctcaattat
gacatgcacaacccctttgacatttgtgctgcatcatatcggcccatctaccgtggaaag
ccagtagaaaagtgtccactcagtggggcctgctattcccctgagttcaaaggtcaaatc
tgcagggtcaccacagtgacagagattggcaaagatgtgattggtttaaggatcagtcct
ctgcagtttcgctaa

DBGET integrated database retrieval system