KEGG   Homo sapiens (human): 131405
Entry
131405            CDS       T01001                                 

Gene name
TRIM71, HYDCC1, LIN-41, LIN41
Definition
(RefSeq) tripartite motif containing 71
  KO
K12035  tripartite motif-containing protein 71 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    131405 (TRIM71)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    131405 (TRIM71)
   04121 Ubiquitin system [BR:hsa04121]
    131405 (TRIM71)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     131405 (TRIM71)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     131405 (TRIM71)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    131405 (TRIM71)
SSDB
Motif
Pfam: NHL Filamin DUF5128 zf-B_box SGL zf-RING_5 zf-C3HC4 zf-RING_UBOX
Other DBs
NCBI-GeneID: 131405
NCBI-ProteinID: NP_001034200
OMIM: 618570
HGNC: 32669
Ensembl: ENSG00000206557
Vega: OTTHUMG00000155778
Pharos: Q2Q1W2(Tbio)
UniProt: Q2Q1W2
Position
3p22.3
AA seq 868 aa
MASFPETDFQICLLCKEMCGSPAPLSSNSSASSSSSQTSTSSGGGGGGPGAAARRLHVLP
CLHAFCRPCLEAHRLPAAGGGAAGEPLKLRCPVCDQKVVLAEAAGMDALPSSAFLLSNLL
DAVVATADEPPPKNGRAGAPAGAGGHSNHRHHAHHAHPRASASAPPLPQAPQPPAPSRSA
PGGPAASPSALLLRRPHGCSSCDEGNAASSRCLDCQEHLCDNCVRAHQRVRLTKDHYIER
GPPGPGAAAAAQQLGLGPPFPGPPFSILSVFPERLGFCQHHDDEVLHLYCDTCSVPICRE
CTMGRHGGHSFIYLQEALQDSRALTIQLLADAQQGRQAIQLSIEQAQTVAEQVEMKAKVV
QSEVKAVTARHKKALEERECELLWKVEKIRQVKAKSLYLQVEKLRQNLNKLESTISAVQQ
VLEEGRALDILLARDRMLAQVQELKTVRSLLQPQEDDRVMFTPPDQALYLAIKSFGFVSS
GAFAPLTKATGDGLKRALQGKVASFTVIGYDHDGEPRLSGGDLMSAVVLGPDGNLFGAEV
SDQQNGTYVVSYRPQLEGEHLVSVTLCNQHIENSPFKVVVKSGRSYVGIGLPGLSFGSEG
DSDGKLCRPWGVSVDKEGYIIVADRSNNRIQVFKPCGAFHHKFGTLGSRPGQFDRPAGVA
CDASRRIVVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGKILVSDTR
NHRIQLFGPDGVFLNKYGFEGALWKHFDSPRGVAFNHEGHLVVTDFNNHRLLVIHPDCQS
ARFLGSEGTGNGQFLRPQGVAVDQEGRIIVADSRNHRVQMFESNGSFLCKFGAQGSGFGQ
MDRPSGIAITPDGMIVVVDFGNNRILVF
NT seq 2607 nt   +upstreamnt  +downstreamnt
atggcttcgttccccgagaccgatttccagatctgcttgctgtgcaaggagatgtgcggc
tcgccggcgccgctctcctccaactcgtccgcgtcgtcgtcctcctcgcagacgtccacg
tcgtcggggggcggcggcgggggccctggggcggcggcgcgccgcctacacgtcctgccc
tgcctgcacgccttctgccgcccctgcctcgaggcgcaccggctgccggcggcgggcggc
ggcgcggcgggagagccgctcaagctgcgctgccccgtgtgcgaccagaaagtagtgcta
gccgaggcggcgggtatggacgcgctgccttcgtccgccttcctgcttagcaacctgctc
gacgcggtggtggccactgccgacgagccgccgcccaagaacgggcgcgccggcgctccg
gcgggagcgggcggccacagcaaccaccggcaccacgctcaccacgcgcacccgcgcgcg
tccgcctccgcgccgccactcccgcaggcgccgcagccgcccgcgccttcccgctcggca
cccggcggccctgccgcttccccgtcggcgctgctgctccgccgtcctcacggctgcagc
tcgtgcgatgagggcaacgcagcttcttcgcgctgcctcgactgccaggagcacctgtgc
gacaactgcgtccgagcgcaccagcgcgtgcgcctcaccaaggaccactacatcgagcgc
ggcccgccgggtcccggtgccgcagcagcggcgcagcagctcgggctcgggccgcccttt
cccggcccgcccttctccatcctctcagtgtttcccgagcgcctcggcttctgccagcac
cacgacgacgaggtgctgcacctgtactgtgacacttgctctgtacccatctgtcgtgag
tgcacaatgggccggcatgggggccacagcttcatctacctccaggaggcactgcaggac
tcacgggcactcaccatccagctgctggcagatgcccagcagggacgacaggcaatccag
ctgagcatcgagcaggcccagacggtggcggaacaggtggagatgaaggcgaaggttgtg
cagtcggaggtcaaagccgtgacggcgaggcataagaaagccctggaggaacgcgagtgt
gagctgctgtggaaggtagaaaagatccgccaggtgaaagccaagtctctgtacctgcag
gtggagaagctgcggcaaaacctcaacaagcttgagagcaccatcagtgccgtgcagcag
gtcctggaggagggtagagcgctagacatcctactggcccgagaccggatgctggcccag
gtgcaggagctgaagaccgtgcggagcctcctgcagccccaggaagacgaccgagtcatg
ttcacaccccccgatcaggcactgtaccttgccatcaagtcttttggctttgttagcagc
ggggcctttgccccactcaccaaggccacaggcgatggcctcaagcgtgccctccagggt
aaggtggcctccttcacagtcattggttatgaccacgatggtgagccccgcctctcagga
ggcgacctgatgtcggctgtggtcctgggccctgatggcaacctgtttggtgcagaggtg
agtgatcagcagaatgggacatacgtggtgagttaccgaccccagctggagggtgagcac
ctggtatctgtgacactgtgcaaccagcacattgagaacagccctttcaaggtggtggtc
aagtcaggccgcagctacgtgggcattgggctcccgggcctgagcttcggcagtgagggt
gacagcgatggcaagctctgccgcccttggggtgtgagtgtagacaaggagggctacatc
attgtcgccgaccgcagcaacaaccgcatccaggtgttcaagccctgcggcgccttccac
cacaaattcggcaccctgggctcccggcctgggcagttcgaccgaccagccggcgtggcc
tgtgacgcctcacgcaggatcgtggtggctgacaaggacaatcatcgcatccagatcttc
acgttcgagggccagttcctcctcaagtttggtgagaaaggaaccaagaatgggcagttc
aactacccttgggatgtggcggtgaattctgagggcaagatcctggtctcagacacgagg
aaccaccggatccagctgtttgggcctgatggtgtcttcctaaacaagtatggcttcgag
ggggctctctggaagcactttgactccccacggggtgtggccttcaaccatgagggccac
ttggtggtcactgacttcaacaaccaccggctcctggttattcaccccgactgccagtcg
gcacgctttctgggctcggagggcacaggcaatgggcagttcctgcgcccacaaggggta
gctgtggaccaggaagggcgcatcattgtggcggattccaggaaccatcgggtacagatg
tttgaatccaacggcagcttcctgtgcaagtttggtgctcaaggcagcggctttgggcag
atggaccgcccttccggcatcgccatcacccccgacggaatgatcgttgtggtggacttt
ggcaacaatcgaatcctcgtcttctaa

DBGET integrated database retrieval system