KEGG   Homo sapiens (human): 131450Help
Entry
131450            CDS       T01001                                 

Gene name
CD200R1, CD200R, HCRTR2, MOX2R, OX2R
Definition
(RefSeq) CD200 receptor 1
  KO
K21668  cell surface glycoprotein CD200 receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    131450 (CD200R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2-set_2 V-set Ig_3 Fig1
Motif
Other DBs
NCBI-GeneID: 131450
NCBI-ProteinID: NP_740750
OMIM: 607546
HGNC: 24235
Ensembl: ENSG00000163606
Vega: OTTHUMG00000159298
Pharos: Q8TD46(Tbio)
UniProt: Q8TD46
Position
3q13.2
AA seq 325 aa AA seqDB search
MLCPWRTANLGLLLILTIFLVAASSSLCMDEKQITQNYSKVLAEVNTSWPVKMATNAVLC
CPPIALRNLIIITWEIILRGQPSCTKAYKKETNETKETNCTDERITWVSRPDQNSDLQIR
TVAITHDGYYRCIMVTPDGNFHRGYHLQVLVTPEVTLFQNRNRTAVCKAVAGKPAAHISW
IPEGDCATKQEYWSNGTVTVKSTCHWEVHNVSTVTCHVSHLTGNKSLYIELLPVPGAKKS
AKLYIPYIILTIIILTIVGFIWLLKVNGCRKYKLNKTESTPVVEEDEMQPYASYTEKNNP
LYDTTNKVKASEALQSEVDTDLHTL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgctctgcccttggagaactgctaacctagggctactgttgattttgactatcttctta
gtggccgcttcaagcagtttatgtatggatgaaaaacagattacacagaactactcgaaa
gtactcgcagaagttaacacttcatggcctgtaaagatggctacaaatgctgtgctttgt
tgccctcctatcgcattaagaaatttgatcataataacatgggaaataatcctgagaggc
cagccttcctgcacaaaagcctacaagaaagaaacaaatgagaccaaggaaaccaactgt
actgatgagagaataacctgggtctccagacctgatcagaattcggaccttcagattcgt
accgtggccatcactcatgacgggtattacagatgcataatggtaacacctgatgggaat
ttccatcgtggatatcacctccaagtgttagttacacctgaagtgaccctgtttcaaaac
aggaatagaactgcagtatgcaaggcagttgcagggaagccagctgcgcatatctcctgg
atcccagagggcgattgtgccactaagcaagaatactggagcaatggcacagtgactgtt
aagagtacatgccactgggaggtccacaatgtgtctaccgtgacctgccacgtctcccat
ttgactggcaacaagagtctgtacatagagctacttcctgttccaggtgccaaaaaatca
gcaaaattatatattccatatatcatccttactattattattttgaccatcgtgggattc
atttggttgttgaaagtcaatggctgcagaaaatataaattgaataaaacagaatctact
ccagttgttgaggaggatgaaatgcagccctatgccagctacacagagaagaacaatcct
ctctatgatactacaaacaaggtgaaggcatctgaggcattacaaagtgaagttgacaca
gacctccatactttataa

DBGET integrated database retrieval system