KEGG   Homo sapiens (human): 1315Help
Entry
1315              CDS       T01001                                 

Gene name
COPB1, COPB
Definition
(RefSeq) coatomer protein complex subunit beta 1
  KO
K17301  coatomer subunit beta
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1315 (COPB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1315 (COPB1)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    1315 (COPB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   1315 (COPB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adaptin_N Coatamer_beta_C Coatomer_b_Cpla Cnd1 HEAT HEAT_2 MMS19_N DUF5578 AP4E_app_platf
Motif
Other DBs
NCBI-GeneID: 1315
NCBI-ProteinID: NP_001137533
OMIM: 600959
HGNC: 2231
Ensembl: ENSG00000129083
Vega: OTTHUMG00000165824
Pharos: P53618(Tbio)
UniProt: P53618
Position
11p15.2
AA seq 953 aa AA seqDB search
MTAAENVCYTLINVPMDSEPPSEISLKNDLEKGDVKSKTEALKKVIIMILNGEKLPGLLM
TIIRFVLPLQDHTIKKLLLVFWEIVPKTTPDGRLLHEMILVCDAYRKDLQHPNEFIRGST
LRFLCKLKEAELLEPLMPAIRACLEHRHSYVRRNAVLAIYTIYRNFEHLIPDAPELIHDF
LVNEKDASCKRNAFMMLIHADQDRALDYLSTCIDQVQTFGDILQLVIVELIYKVCHANPS
ERARFIRCIYNLLQSSSPAVKYEAAGTLVTLSSAPTAIKAAAQCYIDLIIKESDNNVKLI
VLDRLIELKEHPAHERVLQDLVMDILRVLSTPDLEVRKKTLQLALDLVSSRNVEELVIVL
KKEVIKTNNVSEHEDTDKYRQLLVRTLHSCSVRFPDMAANVIPVLMEFLSDNNEAAAADV
LEFVREAIQRFDNLRMLIVEKMLEVFHAIKSVKIYRGALWILGEYCSTKEDIQSVMTEIR
RSLGEIPIVESEIKKEAGELKPEEEITVGPVQKLVTEMGTYATQSALSSSRPTKKEEDRP
PLRGFLLDGDFFVAASLATTLTKIALRYVALVQEKKKQNSFVAEAMLLMATILHLGKSSL
PKKPITDDDVDRISLCLKVLSECSPLMNDIFNKECRQSLSHMLSAKLEEEKLSQKKESEK
RNVTVQPDDPISFMQLTAKNEMNCKEDQFQLSLLAAMGNTQRKEAADPLASKLNKVTQLT
GFSDPVYAEAYVHVNQYDIVLDVLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPH
DFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEF
RQMWAEFEWENKVTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSI
FGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKTSI
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgacggcggctgagaacgtatgctacacgttaattaacgtgccaatggattcagaacca
ccatctgaaattagcttaaaaaatgatctagaaaaaggagatgtaaagtcaaagactgaa
gctttgaagaaagtaatcattatgattctgaatggtgaaaaacttcctggacttctgatg
accatcattcgttttgtgctacctcttcaggatcacactatcaagaaattacttctggta
ttttgggaaattgttcctaaaacaactccagatgggagacttttacatgagatgatcctt
gtatgtgatgcatacagaaaggatcttcaacatcctaatgaatttattcgaggatctact
cttcgttttctttgcaaattgaaagaagcagaattgctagaacctttaatgccagctatt
cgtgcatgtttggagcatcgacacagctatgttagaagaaatgctgttttggccatctat
accatctatagaaattttgaacatcttatacctgatgctcctgaactgatacatgatttt
ctggtgaatgagaaggatgcaagttgcaaaaggaatgcatttatgatgctaattcatgca
gatcaggatcgagctttggattacttaagtacttgcattgatcaagttcaaacatttgga
gacattctgcagctggttattgttgaactgatttataaggtctgtcatgctaatccatca
gaaagagctcgttttattcgctgcatctataacttattacagtcatccagccctgctgta
aaatatgaagctgctgggacattagtgacactctctagtgcaccaactgcaatcaaggct
gctgctcagtgttacattgatttaattattaaggagagcgacaacaatgtaaaactcata
gttttggatcgcttgatagaattaaaagagcatcctgctcatgaacgagtactacaggat
ctggttatggatatcctaagagtattgagcacaccagacttagaagtacgaaagaaaact
ctgcagttagcactggatcttgtctcttctagaaatgttgaagagctggttattgtcctg
aagaaggaagtgataaaaacaaataatgtgtctgagcatgaagatactgacaaatacaga
caactcctagtgcgaacattgcattcctgttctgtccgatttccagatatggctgcaaat
gttattcctgtgttaatggaatttctcagtgacaacaacgaagcagcagctgctgatgtc
ttggagtttgttcgtgaagccattcagcgctttgataacctgagaatgcttattgttgag
aagatgcttgaagtctttcatgctattaaatctgtcaagatttaccgaggagcattatgg
atcctgggagaatactgtagtaccaaggaagacattcagagtgtgatgactgagatccgc
aggtcccttggagagatcccaattgtagagtcagaaataaagaaagaagctggtgaatta
aaacctgaagaagaaataactgtagggccagttcagaaattggttactgaaatgggtacc
tatgcaactcagagtgcccttagcagttctagacccaccaagaaagaggaagacagacct
cccttgagaggattccttctggatggagatttctttgttgctgcctcccttgccacaact
ctgaccaagattgcattgcgctatgtagctttggttcaggagaagaaaaagcaaaattct
tttgttgctgaggctatgttgctcatggctactatcctgcatttgggaaaatcctctctt
cctaagaagccaattactgatgatgatgtggatcgaatttccctgtgcctcaaggtcttg
tctgaatgttcacctttaatgaatgacattttcaataaggaatgcagacagtccctttct
cacatgttatctgctaaactagaagaagagaaattatcccaaaagaaagaatctgaaaag
aggaatgtgacagtacagcctgatgaccccatttccttcatgcaactaactgctaagaat
gaaatgaactgcaaggaagatcagtttcagctgagtttactggcagcaatgggtaacaca
cagaggaaagaggcagcagatcccctagcatctaaacttaacaaggtcacccaattgaca
ggtttctcagatcctgtatatgcagaagcttacgttcatgtcaaccaatatgatattgtc
ctggatgtacttgttgtgaaccaaaccagtgatactttgcagaattgcacattagaacta
gctacactaggggatctgaaacttgtggaaaagccgtctcctttgactcttgctcctcat
gacttcgcaaatattaaagctaacgtcaaagtagcatcaacagaaaatggaataattttt
ggtaatatagtttatgatgtctctggagcagcaagtgacagaaattgtgtggttctcagt
gatattcacatcgacatcatggactatatccagcctgcaacttgcactgatgcagaattc
cgtcagatgtgggccgaatttgaatgggaaaacaaagtgacagttaacaccaacatggtt
gatttaaatgactacttacagcacatattaaagtcaaccaatatgaaatgcctgactcca
gaaaaggccctttctggttactgtggctttatggcagccaacctttatgctcgttccata
tttggtgaagatgcacttgcaaatgtcagcattgagaagccaattcaccagggaccagat
gctgctgttaccggccatataagaattcgtgcaaagagccagggaatggccttaagtctt
ggagataaaatcaacttgtcacagaagaaaactagtatataa

DBGET integrated database retrieval system