KEGG   Homo sapiens (human): 131578
Entry
131578            CDS       T01001                                 

Gene name
LRRC15, LIB
Definition
(RefSeq) leucine rich repeat containing 15
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: LRR_8 LRR_5 LRR_4 LRR_1 LRR_9
Other DBs
NCBI-GeneID: 131578
NCBI-ProteinID: NP_570843
HGNC: 20818
Ensembl: ENSG00000172061
Vega: OTTHUMG00000156048
Pharos: Q8TF66(Tbio)
UniProt: Q8TF66 B3KWI4
Position
3q29
AA seq 581 aa
MPLKHYLLLLVGCQAWGAGLAYHGCPSECTCSRASQVECTGARIVAVPTPLPWNAMSLQI
LNTHITELNESPFLNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLPIGL
FQGLDSLESLLLSSNQLLQIQPAHFSQCSNLKELQLHGNHLEYIPDGAFDHLVGLTKLNL
GKNSLTHISPRVFQHLGNLQVLRLYENRLTDIPMGTFDGLVNLQELALQQNQIGLLSPGL
FHNNHNLQRLYLSNNHISQLPPSVFMQLPQLNRLTLFGNSLKELSPGIFGPMPNLRELWL
YDNHISSLPDNVFSNLRQLQVLILSRNQISFISPGAFNGLTELRELSLHTNALQDLDGNV
FRMLANLQNISLQNNRLRQLPGNIFANVNGLMAIQLQNNQLENLPLGIFDHLGKLCELRL
YDNPWRCDSDILPLRNWLLLNQPRLGTDTVPVCFSPANVRGQSLIIINVNVAVPSVHVPE
VPSYPETPWYPDTPSYPDTTSVSSTTELTSPVEDYTDLTTIQVTDDRSVWGMTQAQSGLA
IAAIVIGIVALACSLAACVGCCCCKKRSQAVLMQMKAPNEC
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgccactgaagcattatctccttttgctggtgggctgccaagcctggggtgcagggttg
gcctaccatggctgccctagcgagtgtacctgctccagggcctcccaggtggagtgcacc
ggggcacgcattgtggcagtgcccacccctctgccctggaacgccatgagcctgcagatc
ctcaacacgcacatcactgaactcaatgagtccccgttcctcaatatctcagccctcatc
gccctgaggattgagaagaatgagctgtcgcgcatcacgcctggggccttccgaaacctg
ggctcgctgcgctatctcagcctcgccaacaacaagctgcaggttctgcccatcggcctc
ttccagggcctggacagcctcgagtctctccttctgtccagtaaccagctgttgcagatc
cagccggcccacttctcccagtgcagcaacctcaaggagctgcagttgcacggcaaccac
ctggaatacatccctgacggagccttcgaccacctggtaggactcacgaagctcaatctg
ggcaagaatagcctcacccacatctcacccagggtcttccagcacctgggcaacctccag
gtcctccggctgtatgagaacaggctcacggatatccccatgggcacttttgatgggctt
gttaacctgcaggaactggctctgcagcagaaccagattggactgctctcccctggtctc
ttccacaacaaccacaacctccagagactctacctgtccaacaaccacatctcccagctg
ccacccagcgtcttcatgcagctgccccagctcaaccgtcttactctctttgggaattcc
ctgaaggagctctctccggggatcttcgggcccatgcccaacctgcgggagctttggctc
tatgacaaccacatctcttctctacccgacaatgtcttcagcaacctccgccagttgcag
gtcctgattcttagccgcaatcagatcagcttcatctccccgggtgccttcaacgggcta
acggagcttcgggagctgtccctccacaccaacgcactgcaggacctggacgggaacgtc
ttccgcatgttggccaacctgcagaacatctccctgcagaacaaccgcctcagacagctc
ccagggaatatcttcgccaacgtcaatggcctcatggccatccagctgcagaacaaccag
ctggagaacttgcccctcggcatcttcgatcacctggggaaactgtgtgagctgcggctg
tatgacaatccctggaggtgtgactcagacatccttccgctccgcaactggctcctgctc
aaccagcctaggttagggacggacactgtacctgtgtgtttcagcccagccaatgtccga
ggccagtccctcattatcatcaatgtcaacgttgctgttccaagcgtccatgtccccgag
gtgcctagttacccagaaacaccatggtacccagacacacccagttaccctgacaccaca
tccgtctcttctaccactgagctaaccagccctgtggaagactacactgatctgactacc
attcaggtcactgatgaccgcagcgtttggggcatgacccaggcccagagcgggctggcc
attgccgccattgtaattggcattgtcgccctggcctgctccctggctgcctgcgtcggc
tgttgctgctgcaagaagaggagccaagctgtcctgatgcagatgaaggcacccaatgag
tgttaa

DBGET integrated database retrieval system