KEGG   Homo sapiens (human): 131873Help
Entry
131873            CDS       T01001                                 

Gene name
COL6A6
Definition
(RefSeq) collagen type VI alpha 6 chain
  KO
K06238  collagen, type VI, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04974  Protein digestion and absorption
hsa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    131873 (COL6A6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    131873 (COL6A6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    131873 (COL6A6)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    131873 (COL6A6)
 09160 Human Diseases
  09167 Infectious diseases
   05165 Human papillomavirus infection
    131873 (COL6A6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    131873 (COL6A6)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    131873 (COL6A6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   131873 (COL6A6)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   131873 (COL6A6)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   131873 (COL6A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWA VWA_2 Collagen VWA_CoxE Radical_SAM Integrin_beta DUF5035
Motif
Other DBs
NCBI-GeneID: 131873
NCBI-ProteinID: NP_001096078
OMIM: 616613
HGNC: 27023
Ensembl: ENSG00000206384
Vega: OTTHUMG00000159653
Pharos: A6NMZ7(Tdark)
UniProt: A6NMZ7
Position
3q22.1
AA seq 2263 aa AA seqDB search
MMLLILFLVIICSHISVNQDSGPEYADVVFLVDSSDRLGSKSFPFVKMFITKMISSLPIE
ADKYRVALAQYSDKLHSEFHLSTFKGRSPMLNHLRKNFGFIGGSLQIGKALQEAHRTYFS
APANGRDKKQFPPILVVLASSESEDNVEEASKALRKDGVKIISVGVQKASEENLKAMATS
QFHFNLRTVRDLSMFSQNMTHIIKDVIKYKEGAVDDIFVEACQGPSMADVVFLLDMSING
SEENFDYLKGFLEESVSALDIKENCMRVGLVAYSNETKVINSLSMGINKSEVLQHIQNLS
PRTGKAYTGAAIKKLRKEVFSARNGSRKNQGVPQIAVLVTHRDSEDNVTKAAVNLRREGV
TIFTLGIEGASDTQLEKIASHPAEQYVSKLKTFADLAAHNQTFLKKLRNQITHTVSVFSE
RTETLKSGCVDTEEADIYLLIDGSGSTQATDFHEMKTFLSEVVGMFNIAPHKVRVGAVQY
ADSWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLLQKAKKQRGNKVPCH
LVVLTNGMSKDSILEPANRLREEHIRVYAIGIKEANQTQLREIAGEEKRVYYVHDFDALK
DIRNQVVQEICTEEACKEMKADIMFLVDSSGSIGPENFSKMKTFMKNLVSKSQIGPDRVQ
IGVVQFSDINKEEFQLNRFMSQSDISNAIDQMAHIGQTTLTGSALSFVSQYFSPTKGARP
NIRKFLILITDGEAQDIVKEPAVVLRQEGVIIYSVGVFGSNVTQLEEISGRPEMVFYVEN
FDILQRIEDDLVFGICSPREECKRIEVLDVVFVIDSSGSIDYDEYNIMKDFMIGLVKKAD
VGKNQVRFGALKYADDPEVLFYLDDFGTKLEVISVLQNDQAMGGSTYTAEALGFSDHMFT
EARGSRLNKGVPQVLIVITDGESHDADKLNATAKALRDKGILVLAVGIDGANPVELLAMA
GSSDKYFFVETFGGLKGIFSDVTASVCNSSKVDCEIDKVDLVFLMDGSTSIQPNDFKKMK
EFLASVVQDFDVSLNRVRIGAAQFSDTYHPEFPLGTFIGEKEISFQIENIKQIFGNTHIG
AALREVEHYFRPDMGSRINTGTPQVLLVLTDGQSQDEVAQAAEALRHRGIDIYSVGIGDV
DDQQLIQITGTAEKKLTVHNFDELKKVNKRIVRNICTTAGESNCFVDVVVGFDVSTQEKG
QTLLEGQPWMETYLQDILRAISSLNGVSCEVGTETQVSVAFQVTNAMEKYSPKFEIYSEN
ILNSLKDITVKGPSLLNANLLDSLWDTFQNKSAARGKVVLLFSDGLDDDVEKLEQKSDEL
RKEGLNALITVALDGPADSSDLADLPYIEFGKGFEYRTQLSIGMRELGSRLSKQLVNVAE
RTCCCLFCKCIGGDGTMGDPGPPGKRGPPGFKGSEGYLGEEGIAGERGAPGPVGEQGTKG
CYGTKGPKGNRGLNGQEGEVGENGIDGLNGEQGDNGLPGRKGEKGDEGSQGSPGKRGTPG
DRGAKGLRGDPGAPGVDSSIEGPTGLKGERGRQGRRGWPGPPGTPGSRRKTAAHGRRGHT
GPQGTAGIPGPDGLEGSLGLKGPQGPRGEAGVKGEKGGVGSKGPQGPPGPGGEAGNQGRL
GSQGNKGEPGDLGEKGAVGFPGPRGLQGNDGSPGYGSVGRKGAKGQEGFPGESGPKGEIG
DPGGPGETGLKGARGKMISAGLPGEMGSPGEPGPPGRKGVKGAKGLASFSTCELIQYVRD
RSPGRHGKPECPVHPTELVFALDHSRDVTEQEFERMKEMMAFLVRDIKVRENSCPVGAHI
AILSYNSHARHLVRFSDAYKKSQLLREIETIPYERSSASREIGRAMRFISRNVFKRTLPG
AHTRKIATFFSSGQSADAHSITTAAMEFGALEIIPVVITFSNVPSVRRAFAIDDTGTFQV
IVVPSGADYIPALERLQRCTFCYDVCKPDASCDQARPPPVQSYMDAAFLLDASRNMGSAE
FEDIRAFLGALLDHFEITPEPETSVTGDRVALLSHAPPDFLPNTQKSPVRAEFNLTTYRS
KRLMKRHVHESVKQLNGDAFIGHALQWTLDNVFLSTPNLRRNKVIFVISAGETSHLDGEI
LKKESLRAKCQGYALFVFSLGPIWDDKELEDLASHPLDHHLVQLGRIHKPDHSYGVKFVK
SFINSIRRAINKYPPINLKIKCNRLNSIDPKQPPRPFRSFVPGPLKATLKEDVLQKAKFF
QDKKYLSRVARSGRDDAIQNFMRSTSHTFKNGRMIESAPKQHD
NT seq 6792 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgctaattttgttcctcgtgataatttgttcccatatttctgtgaaccaagat
tccggccctgagtatgcagatgttgtgtttttggtggacagctctgatcgcctgggatcc
aagtccttcccatttgtgaaaatgttcatcaccaaaatgatcagcagtctccccatagag
gccgacaaataccgtgtggccctggcccagtacagtgataaacttcacagtgaattccac
ctgagcaccttcaaaggcaggagccccatgctgaaccacctaaggaagaactttggattc
attggcgggtccctgcagataggaaaggctcttcaggaggctcacaggacttatttctct
gcacccgcaaatgggagagacaagaaacagtttcccccaattctagtggtcctggcttca
tctgagtctgaggataatgtggaagaggcatcaaaggccctgcggaaagacggagtgaaa
atcatctctgtaggggtgcagaaagcttctgaggaaaacctgaaggccatggccacgtct
cagtttcatttcaaccttcggacagtcagagacctcagcatgttttcccaaaacatgaca
cacatcatcaaggatgtaataaagtacaaggagggagcagttgatgacatctttgtagaa
gcttgccaaggcccttctatggccgatgttgtgttcctattggatatgtcaatcaatgga
agtgaggagaactttgactatcttaaaggattcttggaagaaagtgtatctgcccttgac
ataaaggaaaattgcatgagggttggccttgtggcctatagcaatgagacaaaagtgata
aattcactgagcatgggcataaataagtcagaggttctccagcatatacagaacctttct
ccccgaactgggaaggcctatactggagctgccatcaaaaagctcaggaaggaagttttt
agtgcacggaatggcagtcggaagaatcagggggtgccccagattgccgtgctggtgacc
caccgagattcagaagacaacgtgacaaaagcagctgttaacctccgacgggagggtgtg
accatcttcaccctgggcatagagggcgccagcgacacccagttggaaaagatagcatcc
caccctgctgagcagtatgtctccaaactgaagaccttcgctgacctggctgctcacaac
cagacatttctgaagaagctgcggaaccaaataacacacacagtctctgtcttttcagag
aggactgaaacgctcaaatctggttgtgtggacactgaggaagcagacatctatctgctt
atcgatggctcagggagcacccaggccacagatttccatgaaatgaagacgttcctgtca
gaggtggtagggatgttcaacattgctccccataaggtgcgggttggggccgttcagtat
gctgacagctgggacttggaatttgagatcaataaatactccaacaagcaggatttggga
aaggccattgagaatatcaggcagatgggtgggaatacaaacacaggcgcagcactgaat
ttcacactgagtctgttgcaaaaagcaaagaagcagcgaggaaacaaagttccatgccac
cttgttgtcctgacaaatggcatgtccaaggatagcatcttggagcctgcaaacagactg
agagaagagcacatccgagtttatgctatcgggatcaaggaggccaaccaaacacagctg
agagaaattgcaggagaggaaaagagagtgtattacgtgcatgactttgatgcattgaaa
gacataagaaaccaagttgttcaagaaatctgtactgaagaagcttgcaaagagatgaaa
gctgacatcatgtttctggtggacagttctggaagtataggacctgaaaacttcagcaaa
atgaaaacatttatgaaaaacctggtgagcaagtctcagattggaccagatcgggtgcaa
attggtgtagtccagttcagcgacatcaataaggaagagtttcagctcaacagattcatg
tcccaaagcgacatttcaaatgcaatagaccaaatggctcacattggacaaaccaccctg
actggtagtgccctgagctttgtgtctcagtacttcagccccaccaagggcgcccggccc
aacatcagaaagtttctcatcctcatcacggatggtgaagctcaggacatagtaaaggaa
ccagcagtagtgcttcggcaagaaggtgtaatcatctattctgtgggagtgtttggctcc
aatgtcacccagcttgaggagatcagtgggaggcccgagatggttttttatgttgagaat
tttgacattctgcagcgcattgaagatgatcttgtttttggaatatgcagcccccgtgaa
gaatgcaagcggattgaagttttagacgttgtgtttgtcattgatagctctggcagtatt
gactatgatgagtataatatcatgaaggattttatgattggcttagtgaaaaaagctgat
gtgggcaagaatcaggtccggtttggggctctgaagtatgctgatgacccagaggtgctg
ttttatctggatgactttggcacaaaactggaggtaatttcagtgctccagaatgaccaa
gccatgggtggcagtacttatactgctgaggcactgggcttctcagaccacatgttcact
gaagcccggggcagccgcctgaacaagggggtcccccaagtcctcattgtgatcaccgat
ggggaatcccatgatgctgataaactcaatgccacggcaaaggccttgcgggacaaaggc
attcttgtcctggctgtggggattgatggtgccaatcccgtggagctgttagccatggca
ggatcaagcgacaagtacttcttcgtggagacttttggaggtctgaagggaatattttca
gatgtgacagccagtgtctgcaactcttcaaaagtagattgtgaaattgacaaagtagat
cttgttttccttatggatggttcaactagcattcagccaaatgacttcaagaaaatgaag
gaatttctggcatctgttgttcaagactttgatgtcagcctcaacagagtgcgaatagga
gcggcccagtttagcgatacctatcacccggagtttccactgggaactttcataggtgaa
aaagagatatcatttcagattgaaaacatcaagcagatctttggaaacacacacatcggt
gctgcactcagggaggtggaacattacttcaggccagacatgggcagcaggataaataca
ggtaccccacaggtgctgctggtccttacagatggccagtcccaagacgaggtggcccag
gccgcggaagccctgagacacagaggtatcgacatctactccgtgggcattggggatgtg
gatgaccagcagctcattcagatcaccgggactgcagagaaaaaactgacagtgcacaac
ttcgatgaactgaagaaggtcaataaaaggatcgttcgcaacatctgtaccacagcgggt
gaaagcaactgtttcgtggatgttgtggtgggatttgatgtctcaactcaggagaaaggg
cagactttgcttgaaggtcagccttggatggaaacctaccttcaagacatcttacgtgcc
atcagctccctcaatggagtaagctgtgaggtgggcacagagactcaggtcagtgtggct
tttcaagtgaccaatgccatggaaaaatattctcccaagtttgagatctacagtgaaaac
atactgaatagcttgaaggatataacagttaaaggaccatctcttctcaatgcaaacctc
ttggattctctatgggatacatttcagaataaatcagctgctcgaggaaaggtggtcctt
ttattttcagatggattggatgatgatgttgagaaacttgaacaaaaatctgatgaactt
agaaaagaaggcctgaatgccctcataactgttgctctggatggacctgctgattcaagt
gacttggctgatcttccctatattgaatttgggaaaggatttgagtacaggacacagctc
tctattggcatgagagaacttggaagccggctgtcaaagcagctggtcaatgttgctgaa
aggacatgctgctgtttgttctgcaagtgcattggaggagatggcacaatgggagatcct
ggaccaccagggaaaaggggacctccaggttttaaaggcagtgaaggctacctgggagag
gagggaatcgctggagaaagaggagcccctggaccagtgggagagcaaggtactaaggga
tgctatggcaccaaaggtcctaagggaaacagaggactaaatggacaggagggagaagtt
ggggaaaatggaattgacggattaaacggagaacagggtgataatggtcttcctggaaga
aaaggagaaaagggagatgagggatctcagggaagcccagggaagagagggactcctggt
gaccgtggagcaaagggcctgcgaggggatcccggagctcctggagttgacagtagcata
gaaggacccacaggcttgaaaggagaacgtggaagacaaggcagaagaggctggccaggc
ccccccgggacaccaggctccagaagaaagacagcagctcatggcagaaggggacataca
ggcccacagggaacagcaggcatcccaggaccagatggacttgaaggctccctgggactt
aagggccctcagggcccaagaggagaggctggtgtgaaaggagaaaaaggaggtgtggga
agtaaaggtccccaggggcctccaggacccggaggagaggcagggaatcaaggccgtttg
ggaagccaaggaaataaaggagaacctggagatctgggagaaaaaggagctgttggcttt
cctggtcctcgtggcttgcagggcaatgatggcagtccaggttatggtagtgtcggacgc
aagggagcaaagggacaagaaggattccctggagaaagtggacctaagggtgagattggg
gaccctggtggtccaggagagactgggctgaagggagctagaggcaaaatgatatctgct
gggcttccaggagagatgggatcccctggggaaccaggacctcctggacgtaagggtgtg
aaaggagccaaaggcttggcttcattttctacatgtgagctcattcagtatgtgcgagac
cgcagtcctggcaggcatggaaaaccggaatgcccagtgcacccaaccgagttggtgttt
gccctggaccactcccgggatgtcactgagcaggaatttgagcggatgaaggagatgatg
gctttcctggtgagagacattaaggtccgggagaacagctgccccgtgggagcgcacatc
gccatcctctcctataactcccacgccaggcaccttgtgcgcttctcagacgcctacaag
aagagtcaacttctcagagaaattgaaactattccttatgagagatcctctgccagcagg
gagattggcagagcaatgcggtttatttccaggaatgtcttcaagcggacgcttccgggg
gcacacacgagaaaaatcgccacatttttcagcagcggtcagtccgcggatgcccactcc
atcaccacggctgccatggagttcggcgcgcttgaaatcattcccgtggtgatcactttc
agcaacgtgccctcggtcaggcgcgcatttgcgattgacgacactggcacatttcaagta
atagtggttccctccggggccgactacataccagcattagagagactccagcggtgcact
ttctgctatgatgtgtgcaagccagatgcttcttgtgaccaagccagaccaccccctgtg
cagtcttacatggatgctgctttccttctggatgcctcccggaacatgggaagtgctgaa
tttgaagacataagagccttccttggagcactattagatcactttgaaatcaccccagag
ccggagacttctgtcactggagaccgggtggccctattgagccatgctccccccgacttc
ctacccaacactcagaagagtccagttagagctgagttcaatcttaccacctacagaagt
aagcgcctcatgaagaggcatgtgcacgagtcagttaaacaactaaatggagatgctttt
attggtcatgccttacagtggactctggacaatgtatttttaagtacacccaatctgaga
agaaacaaagtcatatttgtgatatctgctggggaaaccagccacttagatggggaaatc
ttaaagaaggaatccttgcgagccaaatgtcagggatatgccttatttgtgttttccctt
ggccctatttgggatgacaaggaactggaggatctcgccagccaccctttggatcaccac
ctggtccagcttggccgaattcataaacctgaccacagttatggtgtgaagtttgtgaag
tcctttataaactcaatcaggcgtgcaatcaacaaatatccaccaataaacttaaaaata
aagtgcaacagacttaactctatagatccaaagcagcccccacgaccattccgaagcttt
gttcctggaccacttaaagctaccctcaaagaagatgtattacagaaggcaaaattcttt
caagataaaaaatatctttcaagagtagcaagaagtggcagagatgatgctattcaaaat
tttatgagaagcacctcccatacctttaagaatggaaggatgatagaaagtgctcccaaa
caacatgattaa

DBGET integrated database retrieval system