KEGG   Homo sapiens (human): 131890Help
Entry
131890            CDS       T01001                                 

Gene name
GRK7, GPRK7
Definition
(RefSeq) G protein-coupled receptor kinase 7
  KO
K00909  rhodopsin kinase [EC:2.7.11.14]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04144  Endocytosis
hsa04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    131890 (GRK7)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    131890 (GRK7)
  Sensory system
   04744 Phototransduction
    131890 (GRK7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.14  rhodopsin kinase
     131890 (GRK7)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   131890 (GRK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RGS Kinase-like
Motif
Other DBs
NCBI-GeneID: 131890
NCBI-ProteinID: NP_631948
OMIM: 606987
HGNC: 17031
Ensembl: ENSG00000114124
Vega: OTTHUMG00000159068
Pharos: Q8WTQ7(Tchem)
UniProt: Q8WTQ7
Position
3q23
AA seq 553 aa AA seqDB search
MVDMGALDNLIANTAYLQARKPSDCDSKELQRRRRSLALPGLQGCAELRQKLSLNFHSLC
EQQPIGRRLFRDFLATVPTFRKAATFLEDVQNWELAEEGPTKDSALQGLVATCASAPAPG
NPQPFLSQAVATKCQAATTEEERVAAVTLAKAEAMAFLQEQPFKDFVTSAFYDKFLQWKL
FEMQPVSDKYFTEFRVLGKGGFGEVCAVQVKNTGKMYACKKLDKKRLKKKGGEKMALLEK
EILEKVSSPFIVSLAYAFESKTHLCLVMSLMNGGDLKFHIYNVGTRGLDMSRVIFYSAQI
ACGMLHLHELGIVYRDMKPENVLLDDLGNCRLSDLGLAVEMKGGKPITQRAGTNGYMAPE
ILMEKVSYSYPVDWFAMGCSIYEMVAGRTPFKDYKEKVSKEDLKQRTLQDEVKFQHDNFT
EEAKDICRLFLAKKPEQRLGSREKSDDPRKHHFFKTINFPRLEAGLIEPPFVPDPSVVYA
KDIAEIDDFSEVRGVEFDDKDKQFFKNFATGAVPIAWQEEIIETGLFEELNDPNRPTGCE
EGNSSKSGVCLLL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggtggacatgggggccctggacaacctgatcgccaacaccgcctacctgcaggcccgg
aagccctcggactgcgacagcaaagagctgcagcggcggcggcgtagcctggccctgccc
gggctgcagggctgcgcggagctccgccagaagctgtccctgaacttccacagcctgtgt
gagcagcagcccatcggtcgccgcctcttccgtgacttcctagccacagtgcccacgttc
cgcaaggcggcaaccttcctagaggacgtgcagaactgggagctggccgaggagggaccc
accaaagacagcgcgctgcaggggctggtggccacttgtgcgagtgcccctgccccgggg
aacccgcaacccttcctcagccaggccgtggccaccaagtgccaagcagccaccactgag
gaagagcgagtggctgcagtgacgctggccaaggctgaggccatggctttcttgcaagag
cagccctttaaggatttcgtgaccagcgccttctacgacaagtttctgcagtggaaactc
ttcgagatgcaaccagtgtcagacaagtacttcactgagttcagagtgctggggaaaggt
ggttttggggaggtatgtgccgtccaggtgaaaaacactgggaagatgtatgcctgtaag
aaactggacaagaagcggctgaagaagaaaggtggcgagaagatggctctcttggaaaag
gaaatcttggagaaggtcagcagccctttcattgtctctctggcctatgcctttgagagc
aagacccatctctgccttgtcatgagcctgatgaatgggggagacctcaagttccacatc
tacaacgtgggcacgcgtggcctggacatgagccgggtgatcttttactcggcccagata
gcctgtgggatgctgcacctccatgaactcggcatcgtctatcgggacatgaagcctgag
aatgtgcttctggatgacctcggcaactgcaggttatctgacctggggctggccgtggag
atgaagggtggcaagcccatcacccagagggctggaaccaatggttacatggctcctgag
atcctaatggaaaaggtaagttattcctatcctgtggactggtttgccatgggatgcagc
atttatgaaatggttgctggacgaacaccattcaaagattacaaggaaaaggtcagtaaa
gaggatctgaagcaaagaactctgcaagacgaggtcaaattccagcatgataacttcaca
gaggaagcaaaagatatttgcaggctcttcttggctaagaaaccagagcaacgcttagga
agcagagaaaagtctgatgatcccaggaaacatcatttctttaaaacgatcaactttcct
cgcctggaagctggcctaattgaacccccatttgtgccagacccttcagtggtttatgcc
aaagacatcgctgaaattgatgatttctctgaggttcggggggtggaatttgatgacaaa
gataagcagttcttcaaaaactttgcgacaggtgctgttcctatagcatggcaggaagaa
attatagaaacgggactgtttgaggaactgaatgaccccaacagacctacgggttgtgag
gagggtaattcatccaagtctggcgtgtgtttgttattgtaa

DBGET integrated database retrieval system