KEGG   Homo sapiens (human): 132
Entry
132               CDS       T01001                                 

Symbol
ADK, AK
Name
(RefSeq) adenosine kinase
  KO
K00856  adenosine kinase [EC:2.7.1.20]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
Disease
H00184  Hypermethioninemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    132 (ADK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.20  adenosine kinase
     132 (ADK)
SSDB
Motif
Pfam: PfkB Phos_pyr_kin Raf1_N
Other DBs
NCBI-GeneID: 132
NCBI-ProteinID: NP_006712
OMIM: 102750
HGNC: 257
Ensembl: ENSG00000156110
Vega: OTTHUMG00000018506
Pharos: P55263(Tchem)
UniProt: P55263
Structure
PDB: 
1BX4 2I6A 2I6B 4O1L

Position
10q22.2; 10q11-q24
AA seq 362 aa
MAAAEEEPKPKKLKVEAPQALRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAED
KHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHKAATFFGCIGIDKFGEILKRKA
AEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVEKAR
VCYIAGFFLTVSPESVLKVAHHASENNRIFTLNLSAPFISQFYKESLMKVMPYVDILFGN
ETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFA
VLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPD
FH
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggcagctgctgaggaggagccgaagcccaaaaagctgaaggtggaggcgccgcaagcg
ctgagagaaaatattctctttggaatgggaaatcctctgcttgacatctctgctgtagtg
gacaaagatttccttgataagtattctctgaaaccaaatgaccaaatcttggctgaagac
aaacacaaggaactgtttgatgaacttgtgaaaaaattcaaagtcgaatatcatgctggt
ggctctacccagaattcaattaaagtggctcagtggatgattcaacagccacacaaagca
gcaacattttttggatgcattgggatagataaatttggggagatcctgaagagaaaagct
gctgaagcccatgtggatgctcattactacgagcagaatgagcagccaacaggaacttgt
gctgcatgcatcactggtgacaacaggtccctcatagctaatcttgctgctgccaattgt
tataaaaaggaaaaacatcttgatctggagaaaaactggatgttggtagaaaaagcaaga
gtttgttatatagcaggcttttttcttacagtttccccagagtcagtattaaaggtggct
caccatgcttctgaaaacaacaggattttcactttgaatctatctgcaccgtttattagc
cagttctacaaggaatcattgatgaaagttatgccttatgttgatatactttttggaaat
gagacagaagctgccacttttgctagagagcaaggctttgagactaaagacattaaagag
atagccaaaaagacacaagccctgccaaagatgaactcaaagaggcagcgaatcgtgatc
ttcacccaagggagagatgacactataatggctacagaaagtgaagtcactgcttttgct
gtcttggatcaagaccagaaagaaattattgataccaatggagctggagatgcatttgtt
ggaggttttctgtctcaactggtctctgacaagcctctgactgaatgtatccgtgctggc
cactatgcagcaagcatcataattagacggactggctgcacctttcctgagaagccagac
ttccactga

DBGET integrated database retrieval system