KEGG   Homo sapiens (human): 132158Help
Entry
132158            CDS       T01001                                 

Gene name
GLYCTK, HBEBP2, HBEBP4, HBeAgBP4A
Definition
(RefSeq) glycerate kinase
  KO
K11529  glycerate 2-kinase [EC:2.7.1.165]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00030  Pentose phosphate pathway
hsa00260  Glycine, serine and threonine metabolism
hsa00561  Glycerolipid metabolism
hsa00630  Glyoxylate and dicarboxylate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    132158 (GLYCTK)
   00630 Glyoxylate and dicarboxylate metabolism
    132158 (GLYCTK)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    132158 (GLYCTK)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    132158 (GLYCTK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.165  glycerate 2-kinase
     132158 (GLYCTK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4147 MOFRL HAD DIMCO_N
Motif
Other DBs
NCBI-GeneID: 132158
NCBI-ProteinID: NP_660305
OMIM: 610516
HGNC: 24247
Ensembl: ENSG00000168237
Vega: OTTHUMG00000158380
Pharos: Q8IVS8(Tbio)
UniProt: Q8IVS8 A0A024R302
Position
3p21.2
AA seq 523 aa AA seqDB search
MAAALQVLPRLARAPLHPLLWRGSVARLASSMALAEQARQLFESAVGAVLPGPMLHRALS
LDPGGRQLKVRDRNFQLRQNLYLVGFGKAVLGMAAAAEELLGQHLVQGVISVPKGIRAAM
ERAGKQEMLLKPHSRVQVFEGAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGS
ALLPAPIPPVTLEEKQTLTRLLAARGATIQELNTIRKALSQLKGGGLAQAAYPAQVVSLI
LSDVVGDPVEVIASGPTVASSHNVQDCLHILNRYGLRAALPRSVKTVLSRADSDPHGPHT
CGHVLNVIIGSNVLALAEAQRQAEALGYQAVVLSAAMQGDVKSMAQFYGLLAHVARTRLT
PSMAGASVEEDAQLHELAAELQIPDLQLEEALETMAWGRGPVCLLAGGEPTVQLQGSGRG
GRNQELALRVGAELRRWPLGPIDVLFLSGGTDGQDGPTEAAGAWVTPELASQAAAEGLDI
ATFLAHNDSHTFFCCLQGGAHLLHTGMTGTNVMDTHLLFLRPR
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagccctgcaggtcctgccccgcttggcccgagcccccttgcatccactcctc
tggcggggctcagtggcccgtctggccagcagcatggccttggcagagcaggccaggcag
ctgtttgagagtgctgtaggtgcagtgctgccgggccccatgctgcaccgggcactatcc
ttggaccctggtggcagacagctgaaggtgcgggaccggaactttcagctgaggcaaaac
ctctacctggtgggctttggcaaggctgtgctgggtatggcagctgcagctgaggaacta
ctgggccagcatcttgtgcagggcgtgatcagcgttcccaaggggatccgtgctgccatg
gagcgtgccggcaagcaggagatgctgctgaagccacatagccgtgtccaggtattcgag
ggtgcggaggacaacctcccggaccgcgatgcgctgcgggctgcactggccatccagcaa
ctggctgagggactcacagctgatgacctgctgctcgtgctgatctcaggtgggggttca
gctctgctgcctgcccccatcccacctgtcacactggaggagaagcagacactcactaga
ctgctggcagcccgtggagccaccatccaggagttgaacaccattcggaaggccctgtcc
cagctcaagggtggggggctggctcaggccgcctaccctgcccaggtggtgagcctcatc
ctgtcagatgtggtgggggaccctgtggaggtgattgccagtggccccaccgtggccagt
tcccacaatgtgcaagattgcctgcatatcctcaatcgctacggcctccgtgcagccctg
ccacgttctgtgaagactgtgctgtctcgggccgactctgacccccatgggccacacacc
tgtggccatgtcctgaatgtgatcattggctctaatgtgctggcgctagctgaggcccag
cggcaggccgaggcactgggctaccaggctgtggtgctgagtgcagccatgcaaggtgat
gtaaaaagtatggcccagttctacgggctgctggcccatgtggctagaacccgcctcacc
ccatccatggctggggcttctgtggaggaagatgcacagctccatgagctggcagctgag
cttcagatcccagacctgcagctggaggaggctctggagaccatggcatggggaaggggc
ccagtctgcctgctggctggtggcgagcccacagtacagctgcagggctcgggcaggggt
ggccggaaccaggaactggccctgcgtgttggagcagagttgagaaggtggccgctgggg
ccgatagatgtgctgtttttgagcggtggcaccgatgggcaggatgggcccacagaggct
gctggggcctgggtcacacctgagcttgccagccaggctgcagctgagggcctggacata
gccaccttcctagcccacaatgactcacataccttcttctgctgcctccagggtggggca
cacctgctgcacacagggatgacaggtaccaatgtcatggacacccacctcttgttcctg
cggcctcggtga

DBGET integrated database retrieval system