KEGG   Homo sapiens (human): 132430
Entry
132430            CDS       T01001                                 

Symbol
PABPC4L
Name
(RefSeq) poly(A) binding protein cytoplasmic 4 like
  KO
K13126  polyadenylate-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    132430 (PABPC4L)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    132430 (PABPC4L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    132430 (PABPC4L)
   03041 Spliceosome [BR:hsa03041]
    132430 (PABPC4L)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     132430 (PABPC4L)
   mRNA cycle factors
    Stress granule specific factors
     132430 (PABPC4L)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   Complex C specific factors
    132430 (PABPC4L)
SSDB
Motif
Pfam: RRM_1 RRM_5 Limkain-b1 RRM_7 RRM_occluded Nup35_RRM Nup35_RRM_2 RRM_3 RRM_8
Other DBs
NCBI-GeneID: 132430
NCBI-ProteinID: NP_001108206
HGNC: 31955
Ensembl: ENSG00000254535
Vega: OTTHUMG00000161292
Position
4q28.3
AA seq 370 aa
MNVAAKYRMASLYVGDLHADVTEDLLFRKFSTVGPVLSIRICRDQVTRRSLGYAYVNFLQ
LADAQKALDTMNFDIIKGKSIRLMWSQRDAYLRRSGIGNVFIKNLDKSIDNKTLYEHFSA
FGKILSSKVMSDDQGSKGYAFVHFQNQSAADRAIEEMNGKLLKGCKVFVGRFKNRKDREA
ELRSKASEFTNVYIKNFGGDMDDERLKDVFSKYGKTLSVKVMTDSSGKSKGFGFVSFDSH
EAAKKAVEEMNGRDINGQLIFVGRAQKKVERQAELKQMFEQLKRERIRGCQGVKLYIKNL
DDTIDDEKLRNEFSSFGSISRVKVMQEEGQSKGFGLICFSSPEDATKAMTEMNGRILGSK
PLSIALAQRH
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgaatgtagcagccaagtaccgcatggcctccctgtatgtgggtgacttacatgcagat
gtcaccgaggacctgctgttcaggaagttcagcactgtggggcctgtgctgtccatccgc
atttgcagggaccaggtcacccgccgctctctgggctatgcctacgtgaacttcttgcag
ctggctgatgcccagaaggcgctggacacaatgaactttgacatcataaaaggcaaatcc
atccgtctcatgtggtctcagcgcgatgcctacttgaggagatctggaattgggaacgta
ttcatcaagaatctggacaaatctatcgataacaaaaccctttatgaacatttttcagct
tttggaaagatcctttcctccaaggtgatgagtgatgatcaaggctccaagggctatgca
tttgtgcactttcagaaccagagtgctgcagacagggccattgaggagatgaatggaaaa
ctactcaagggctgcaaggtgtttgttggcagattcaaaaaccgaaaagatcgtgaagct
gaactcagaagcaaagccagtgaattcaccaatgtttacataaaaaactttggaggtgac
atggatgatgagagattgaaggacgttttcagcaaatatggcaaaactctgagtgttaag
gtgatgacagattccagtgggaaatccaaaggctttggctttgtgagttttgatagccat
gaggctgccaagaaagctgttgaagaaatgaatggaagggacataaatgggcagctgatt
tttgtaggccgggctcaaaagaaagtcgagcgacaggctgagttaaagcaaatgtttgag
cagctgaaaagggaacgaattcgtgggtgccagggggtaaaactctatattaagaacctt
gatgacaccatcgatgatgaaaaactacgaaacgaattttcttcatttggatcaattagc
agagttaaggtaatgcaggaagaggggcagagcaaagggtttggcttgatctgcttctcc
tctcctgaggatgctactaaagcaatgactgagatgaatggccgcatcttgggctccaaa
cctcttagcattgccttggcccagagacactag

KEGG   Homo sapiens (human): 140886
Entry
140886            CDS       T01001                                 

Symbol
PABPC5, PABP5
Name
(RefSeq) poly(A) binding protein cytoplasmic 5
  KO
K13126  polyadenylate-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    140886 (PABPC5)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    140886 (PABPC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    140886 (PABPC5)
   03041 Spliceosome [BR:hsa03041]
    140886 (PABPC5)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     140886 (PABPC5)
   mRNA cycle factors
    Stress granule specific factors
     140886 (PABPC5)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   Complex C specific factors
    140886 (PABPC5)
SSDB
Motif
Pfam: RRM_1 RRM_5 RRM_occluded RRM_3 TC1
Other DBs
NCBI-GeneID: 140886
NCBI-ProteinID: NP_543022
OMIM: 300407
HGNC: 13629
Ensembl: ENSG00000174740
Vega: OTTHUMG00000021959
Pharos: Q96DU9(Tdark)
UniProt: Q96DU9
Position
Xq21.31
AA seq 382 aa
MGSGEPNPAGKKKKYLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLG
YGYVNFRFPADAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFIKNLDKSIDNR
ALFYLFSAFGNILSCKVVCDDNGSKGYAYVHFDSLAAANRAIWHMNGVRLNNRQVYVGRF
KFPEERAAEVRTRDRATFTNVFVKNIGDDIDDEKLKELFCEYGPTESVKVIRDASGKSKG
FGFVRYETHEAAQKAVLDLHGKSIDGKVLYVGRAQKKIERLAELRRRFERLRLKEKSRPP
GVPIYIKNLDETINDEKLKEEFSSFGSISRAKVMMEVGQGKGFGVVCFSSFEEATKAVDE
MNGRIVGSKPLHVTLGQARRRC
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggggagcggggagcctaatcctgctggcaagaaaaagaagtatctcaaggccgctctg
tacgtgggtgacttggacccagatgtcaccgaggacatgctctataagaagttcaggcct
gctggccctctgcgattcacccgaatctgccgtgatccggtgacccgcagccccctgggc
tatgggtatgttaacttccgctttcccgcggatgcagagtgggccttgaacaccatgaat
tttgatttgattaatggaaaaccattccgccttatgtggtctcagccagatgaccgctta
agaaagtctggagtgggaaatatattcatcaaaaacctggacaaatccatagacaatagg
gccctgttttacttattttctgcttttgggaacattctgtcctgcaaagtcgtatgcgat
gacaacggctctaagggttatgcctatgttcactttgacagcctggccgctgccaataga
gccatctggcacatgaatggagtgcggctcaacaaccgccaggtgtatgttggcagattc
aaattcccagaagagcgggcggctgaggtcagaaccagggatagagcaactttcaccaat
gttttcgttaaaaacattggagacgacatagatgacgaaaaactgaaggaacttttctgt
gaatatgggccaactgagagtgttaaagtaataagagatgccagtgggaaatctaaaggc
tttggatttgtgagatatgagacacacgaggctgcccaaaaggctgtgctagacttgcat
ggaaagtccatcgatggaaaagtcctctatgtagggcgagcacagaagaaaattgaacgc
ctggctgagttgaggcggagatttgaacggctgaggttaaaagaaaaaagtcggccccca
ggggtgcctatctatattaagaacttggatgagacaatcaatgatgaaaaactgaaggag
gaattttcttcctttgggtcaattagtcgggccaaagtgatgatggaagtggggcaaggc
aaaggatttggtgtggtctgcttttcctcttttgaagaggctaccaaagcagtggatgag
atgaatggccgcatagtgggctccaagcccctgcatgtcaccctgggccaggccaggcgc
aggtgctga

KEGG   Homo sapiens (human): 26986
Entry
26986             CDS       T01001                                 

Symbol
PABPC1, PAB1, PABP, PABP1, PABPC2, PABPL1
Name
(RefSeq) poly(A) binding protein cytoplasmic 1
  KO
K13126  polyadenylate-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    26986 (PABPC1)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    26986 (PABPC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    26986 (PABPC1)
   03041 Spliceosome [BR:hsa03041]
    26986 (PABPC1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     26986 (PABPC1)
   mRNA cycle factors
    Stress granule specific factors
     26986 (PABPC1)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   Complex C specific factors
    26986 (PABPC1)
SSDB
Motif
Pfam: RRM_1 PABP RRM_5 RRM_occluded RRM_3 ATP-grasp_2
Other DBs
NCBI-GeneID: 26986
NCBI-ProteinID: NP_002559
OMIM: 604679
HGNC: 8554
Ensembl: ENSG00000070756
Vega: OTTHUMG00000164779
Pharos: P11940(Tbio)
UniProt: P11940 A0A024R9C1
Structure
PDB: 

Position
8q22.3
AA seq 636 aa
MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQ
QPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFS
AFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKERE
AELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFER
HEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKN
LDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVAT
KPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRA
AYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ
RVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQ
GQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESP
ESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgaaccccagtgcccccagctaccccatggcctcgctctacgtgggggacctccacccc
gacgtgaccgaggcgatgctctacgagaagttcagcccggccgggcccatcctctccatc
cgggtctgcagggacatgatcacccgccgctccttgggctacgcgtatgtgaacttccag
cagccggcggacgcggagcgtgctttggacaccatgaattttgatgttataaagggcaag
ccagtacgcatcatgtggtctcagcgtgatccatcacttcgcaaaagtggagtaggcaac
atattcattaaaaatctggacaaatccattgataataaagcactgtatgatacattttct
gcttttggtaacatcctttcatgtaaggtggtttgtgatgaaaatggttccaagggctat
ggatttgtacactttgagacgcaggaagcagctgaaagagctattgaaaaaatgaatgga
atgctcctaaatgatcgcaaagtatttgttggacgatttaagtctcgtaaagaacgagaa
gctgaacttggagctagggcaaaagaattcaccaatgtttacatcaagaattttggagaa
gacatggatgatgagcgccttaaggatctctttggcaagtttgggcctgccttaagtgtg
aaagtaatgactgatgaaagtggaaaatccaaaggatttggatttgtaagctttgaaagg
catgaagatgcacagaaagctgtggatgagatgaacggaaaggagctcaatggaaaacaa
atttatgttggtcgagctcagaaaaaggtggaacggcagacggaacttaagcgcaaattt
gaacagatgaaacaagataggatcaccagataccagggtgttaatctttatgtgaaaaat
cttgatgatggtattgatgatgaacgtctccggaaagagttttctccatttggtacaatc
actagtgcaaaggttatgatggagggtggtcgcagcaaagggtttggttttgtatgtttc
tcctccccagaagaagccactaaagcagttacagaaatgaacggtagaattgtggccaca
aagccattgtatgtagctttagctcagcgcaaagaagagcgccaggctcacctcactaac
cagtatatgcagagaatggcaagtgtacgagctgttcccaaccctgtaatcaacccctac
cagccagcacctccttcaggttacttcatggcagctatcccacagactcagaaccgtgct
gcatactatcctcctagccaaattgctcaactaagaccaagtcctcgctggactgctcag
ggtgccagacctcatccattccaaaatatgcccggtgctatccgcccagctgctcctaga
ccaccatttagtactatgagaccagcttcttcacaggttccacgagtcatgtcaacacag
cgtgttgctaacacatcaacacagacaatgggtccacgtcctgcagctgcagccgctgca
gctactcctgctgtccgcaccgttccacagtataaatatgctgcaggagttcgcaatcct
cagcaacatcttaatgcacagccacaagttacaatgcaacagcctgctgttcatgtacaa
ggtcaggaacctttgactgcttccatgttggcatctgcccctcctcaagagcaaaagcaa
atgttgggtgaacggctgtttcctcttattcaagccatgcaccctactcttgctggtaaa
atcactggcatgttgttggagattgataattcagaacttcttcatatgctcgagtctcca
gagtcactccgttctaaggttgatgaagctgtagctgtactacaagcccaccaagctaaa
gaggctgcccagaaagcagttaacagtgccaccggtgttccaactgtttaa

KEGG   Homo sapiens (human): 340529
Entry
340529            CDS       T01001                                 

Symbol
PABPC1L2A, RBM32A
Name
(RefSeq) poly(A) binding protein cytoplasmic 1 like 2A
  KO
K13126  polyadenylate-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    340529 (PABPC1L2A)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    340529 (PABPC1L2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    340529 (PABPC1L2A)
   03041 Spliceosome [BR:hsa03041]
    340529 (PABPC1L2A)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     340529 (PABPC1L2A)
   mRNA cycle factors
    Stress granule specific factors
     340529 (PABPC1L2A)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   Complex C specific factors
    340529 (PABPC1L2A)
SSDB
Motif
Pfam: RRM_1 RRM_5 Nup35_RRM
Other DBs
NCBI-GeneID: 340529
NCBI-ProteinID: NP_001012995
HGNC: 27989
Ensembl: ENSG00000186288
Vega: OTTHUMG00000021824
UniProt: Q5JQF8
Position
Xq13.2
AA seq 200 aa
MASLYVGDLHPEVTEAMLYEKFSPAGPILSIRICRDKITRRSLGYAYVNYQQPVDAKRAL
ETLNFDVIKGRPVRIMWSQRDPSLRKSGVGNVFIKNLGKTIDNKALYNIFSAFGNILSCK
VACDEKGPKGYGFVHFQKQESAERAIDVMNGMFLNYRKIFVGRFKSHKEREAERGAWARQ
STSADVKDFEEDTDEEATLR
NT seq 603 nt   +upstreamnt  +downstreamnt
atggcctccctgtacgtgggcgacctgcaccctgaggtgaccgaggcaatgctgtacgag
aagttcagtccagctgggcccatcctctccatccgcatctgcagggacaagatcacccgc
cgctcattgggctacgcgtatgtcaactaccagcaaccggtggacgccaagcgggccctg
gagaccctgaactttgatgtcataaagggcaggccagtgcgcatcatgtggtcccagagg
gacccgtcgctccgcaagagcggggtgggcaacgtcttcatcaagaacctgggcaagacc
atcgacaacaaggcgctgtacaacatcttctcggcgttcggcaacatcctctcctgcaaa
gtggcctgtgacgaaaaggggcccaagggctacgggttcgtgcacttccaaaagcaggaa
tctgcggagcgggccatcgatgtgatgaatggcatgttcctgaactaccgcaaaattttc
gtcgggagattcaagtcgcataaagaacgagaggccgaaaggggagcctgggccaggcag
tccactagtgctgacgtcaaggatttcgaggaagacaccgacgaggaggccaccttgcga
tga

KEGG   Homo sapiens (human): 5042
Entry
5042              CDS       T01001                                 

Symbol
PABPC3, PABP3, PABPL3, tPABP
Name
(RefSeq) poly(A) binding protein cytoplasmic 3
  KO
K13126  polyadenylate-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5042 (PABPC3)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    5042 (PABPC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5042 (PABPC3)
   03041 Spliceosome [BR:hsa03041]
    5042 (PABPC3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     5042 (PABPC3)
   mRNA cycle factors
    Stress granule specific factors
     5042 (PABPC3)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   Complex C specific factors
    5042 (PABPC3)
SSDB
Motif
Pfam: RRM_1 PABP RRM_5 RRM_occluded Limkain-b1 RRM_3 HATPase_c ATP-grasp_2
Other DBs
NCBI-GeneID: 5042
NCBI-ProteinID: NP_112241
OMIM: 604680
HGNC: 8556
Ensembl: ENSG00000151846
Vega: OTTHUMG00000016601
Pharos: Q9H361(Tbio)
UniProt: Q9H361 Q5VX58
Structure
PDB: 
4IVE 2D9P

Position
13q12.13
AA seq 631 aa
MNPSTPSYPTASLYVGDLHPDVTEAMLYEKFSPAGPILSIRICRDLITSGSSNYAYVNFQ
HTKDAEHALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFVKNLDKSINNKALYDTVS
AFGNILSCNVVCDENGSKGYGFVHFETHEAAERAIKKMNGMLLNGRKVFVGQFKSRKERE
AELGARAKEFPNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFER
HEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRTFEQMKQDRITRYQVVNLYVKN
LDDGIDDERLRKAFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVAT
KPLYVALAQRKEERQAYLTNEYMQRMASVRAVPNQRAPPSGYFMTAVPQTQNHAAYYPPS
QIARLRPSPRWTAQGARPHPFQNKPSAIRPGAPRVPFSTMRPASSQVPRVMSTQRVANTS
TQTVGPRPAAAAAAAATPAVRTVPRYKYAAGVRNPQQHRNAQPQVTMQQLAVHVQGQETL
TASRLASAPPQKQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLYMLESPESLRS
KVDEAVAVLQAHQAKEATQKAVNSATGVPTV
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgaaccccagcacccccagctacccaacggcctcgctctacgtgggggacctccacccc
gacgtgactgaggcgatgctctacgagaagttcagcccggcagggcccatcctctccatc
cggatctgcagggacttgatcaccagcggctcctccaactacgcgtatgtgaacttccag
catacgaaggacgcggagcatgctctggacaccatgaattttgatgttataaagggcaag
ccagtacgcatcatgtggtctcagcgtgatccatcacttcgaaaaagtggagtgggcaac
atattcgttaaaaatctggataagtccattaataataaagcactgtatgatacagtttct
gcttttggtaacatcctttcgtgtaacgtggtttgtgatgaaaatggttccaagggttat
ggatttgtacactttgagacacacgaagcagctgaaagagctattaaaaaaatgaacgga
atgctcctaaatggtcgcaaagtatttgttggacaatttaagtctcgtaaagaacgagaa
gctgaacttggagctagggcaaaagagttccccaatgtttacatcaagaattttggagaa
gacatggatgatgagcgccttaaggatctctttggcaagttcgggcccgccttaagtgtg
aaagtaatgaccgatgaaagtggaaaatccaaaggatttggatttgtaagctttgaaagg
catgaagatgcacagaaagctgtagatgagatgaatggaaaggagctcaatggaaaacaa
atttacgttggtcgagctcagaaaaaagtggaacggcagacggaacttaagcgcacattt
gaacagatgaagcaagataggatcaccagataccaggttgttaatctttatgtgaaaaat
cttgatgatggtattgatgatgaacgtctccggaaagcgttttctccatttggtacaatc
actagtgcaaaggttatgatggaaggtggtcgcagcaaagggtttggttttgtatgtttc
tcctccccagaagaagccactaaagcagttacagaaatgaacggtagaattgtggccaca
aagccattgtatgtagctttagctcagcgcaaagaagagcgccaggcttacctcactaac
gagtatatgcagagaatggcaagtgtacgagctgtgcccaaccagcgagcacctccttca
ggttacttcatgacagctgtcccacagactcagaaccatgctgcatactatcctcctagc
caaattgctcgactaagaccaagtcctcgctggactgctcagggtgccagacctcatcca
ttccaaaataagcccagtgctatccgcccaggtgctcctagagtaccatttagtactatg
agaccagcttcttcacaggttccacgagtcatgtcaacgcagcgtgttgctaacacatca
acacagacagtgggtccacgtcctgcagctgctgctgctgctgcagctacccctgctgtg
cgcacggttccacggtataaatatgctgcgggagttcgcaatcctcagcaacatcgtaat
gcacagccacaagttacaatgcaacagcttgctgttcatgtacaaggtcaggaaactttg
actgcctccaggttggcatctgcccctcctcaaaagcaaaagcaaatgttaggtgaacgg
ctctttcctcttattcaagccatgcaccctactcttgctgggaaaatcactggcatgttg
ttggagattgataattcagaacttctttatatgctcgagtctccagagtcactccgttct
aaggttgatgaagctgtagctgtactacaagcccaccaagctaaagaggctacccagaaa
gcagttaacagtgctaccggtgttccaactgtttaa

KEGG   Homo sapiens (human): 645974
Entry
645974            CDS       T01001                                 

Symbol
PABPC1L2B, RBM32B
Name
(RefSeq) poly(A) binding protein cytoplasmic 1 like 2B
  KO
K13126  polyadenylate-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    645974 (PABPC1L2B)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    645974 (PABPC1L2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    645974 (PABPC1L2B)
   03041 Spliceosome [BR:hsa03041]
    645974 (PABPC1L2B)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     645974 (PABPC1L2B)
   mRNA cycle factors
    Stress granule specific factors
     645974 (PABPC1L2B)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   Complex C specific factors
    645974 (PABPC1L2B)
SSDB
Motif
Pfam: RRM_1 RRM_5 Nup35_RRM
Other DBs
NCBI-GeneID: 645974
NCBI-ProteinID: NP_001035971
HGNC: 31852
Ensembl: ENSG00000184388
Vega: OTTHUMG00000021823
Pharos: Q5JQF8(Tdark)
UniProt: Q5JQF8
Position
Xq13.2
AA seq 200 aa
MASLYVGDLHPEVTEAMLYEKFSPAGPILSIRICRDKITRRSLGYAYVNYQQPVDAKRAL
ETLNFDVIKGRPVRIMWSQRDPSLRKSGVGNVFIKNLGKTIDNKALYNIFSAFGNILSCK
VACDEKGPKGYGFVHFQKQESAERAIDVMNGMFLNYRKIFVGRFKSHKEREAERGAWARQ
STSADVKDFEEDTDEEATLR
NT seq 603 nt   +upstreamnt  +downstreamnt
atggcctccctgtacgtgggcgacctgcaccctgaggtgaccgaggcaatgctgtacgag
aagttcagtccagctgggcccatcctctccatccgcatctgcagggacaagatcacccgc
cgctcattgggctacgcgtatgtcaactaccagcaaccggtggacgccaagcgggccctg
gagaccctgaactttgatgtcataaagggcaggccagtgcgcatcatgtggtcccagagg
gacccgtcgctccgcaagagcggggtgggcaacgtcttcatcaagaacctgggcaagacc
atcgacaacaaggcgctgtacaacatcttctcggcgttcggcaacatcctctcctgcaaa
gtggcctgtgacgaaaaggggcccaagggctacgggttcgtgcacttccaaaagcaggaa
tctgcggagcgggccatcgatgtgatgaatggcatgttcctgaactaccgcaaaattttc
gtcgggagattcaagtcgcataaagaacgagaggccgaaaggggagcctgggccaggcag
tccactagtgctgacgtcaaggatttcgaggaagacaccgacgaggaggccaccttgcga
tga

KEGG   Homo sapiens (human): 80336
Entry
80336             CDS       T01001                                 

Symbol
PABPC1L, C20orf119, EPAB, PABPC1L1, dJ1069P2.3
Name
(RefSeq) poly(A) binding protein cytoplasmic 1 like
  KO
K13126  polyadenylate-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    80336 (PABPC1L)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    80336 (PABPC1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    80336 (PABPC1L)
   03041 Spliceosome [BR:hsa03041]
    80336 (PABPC1L)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     80336 (PABPC1L)
   mRNA cycle factors
    Stress granule specific factors
     80336 (PABPC1L)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   Complex C specific factors
    80336 (PABPC1L)
SSDB
Motif
Pfam: RRM_1 PABP RRM_5 RRM_7 Limkain-b1 RRM_occluded
Other DBs
NCBI-GeneID: 80336
NCBI-ProteinID: NP_001359108
HGNC: 15797
Ensembl: ENSG00000101104
Vega: OTTHUMG00000032553
Pharos: Q4VXU2(Tdark)
Position
20q13.12
AA seq 619 aa
MNASGSGYPLASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDVATRRSLGYAYINFQ
QPADAERALDTMNFEMLKGQPIRIMWSQRDPGLRKSGVGNIFIKNLEDSIDNKALYDTFS
TFGNILSCKVACDEHGSRGFGFVHFETHEAAQQAINTMNGMLLNDRKVFVGHFKSRRERE
AELGARALEFTNIYVKNLPVDVDEQGLQDLFSQFGKMLSVKVMRDNSGHSRCFGFVNFEK
HEEAQKAVVHMNGKEVSGRLLYAGRAQKRVERQNELKRRFEQMKQDRLRRYQGVNLYVKN
LDDSIDDDKLRKEFSPYGVITSAKVMTEGGHSKGFGFVCFSSPEEATKAVTEMNGRIVGT
KPLYVALAQRKEERKAILTNQYMQRLSTMRTLSNPLLGSFQQPSSYFLPAMPQPPAQAAY
YGCGPVTPTQPAPRWTSQPPRPSSAYPPGASMVRPPVVPRRPPAHISSVRQASTQVPRTV
PHTQRVANIGTQTTGPSGVGCCTPGRPLLPCKCSSAAHSTYRVQEPAVHIPGQEPLTASM
LAAAPLHEQKQMIGERLYPLIHDVHTQLAGKITGMLLEIDNSELLLMLESPESLHAKIDE
AVAVLQAHQAMEQPKAYMH
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgaacgccagcggttctggctacccgcttgcctcgctttacgtgggcgatctgcacccc
gacgtgaccgaggccatgctctatgagaagttctctcccgccggccccatcctgtccatc
cgcgtgtgccgcgatgtagccacccggcgctcgctgggctacgcctacatcaacttccag
cagcccgcggacgcggagcgggcactggacacaatgaactttgagatgctcaaaggccag
cctattcgcatcatgtggtcccagcgagacccaggacttcgcaagtcaggtgtgggcaac
atcttcatcaagaacctggaggactccattgacaacaaggctttatatgataccttctcc
acctttgggaacatcctctcttgcaaggtggcgtgtgacgagcatggctcccggggtttc
ggctttgtccattttgagacccatgaggccgcacagcaggccatcaacaccatgaatggg
atgctgctgaatgaccgcaaagtctttgtgggtcacttcaagtctcgacgggagcgggag
gcggagctgggggcgcgggccctggagttcaccaacatctacgtgaagaacctcccggtg
gatgtggacgagcaaggcctgcaggacctcttctcccagtttgggaaaatgctgagtgtg
aaggtgatgagggacaacagcggccactcgcggtgctttggctttgtcaactttgagaag
catgaggaagcccagaaggccgtggtccatatgaacgggaaggaggtgagcgggcggctg
ctgtacgcgggccgggcccaaaagcgcgtggagcggcagaatgaactgaagcgcaggttt
gagcagatgaagcaggaccggctgaggcgttaccagggtgtgaacttgtatgtgaagaat
ctggacgactccattgatgacgacaaactgaggaaagagttctctccctatggagtaatt
accagtgcgaaggtgatgacagagggtggccacagcaaggggtttggctttgtgtgtttt
tcctccccagaagaggcgacaaaggccgtgacagagatgaacgggcgcatcgtgggcacc
aagccactctacgtggcactggcccagcgcaaagaggagcggaaggccatcttgaccaac
cagtacatgcagcgcctctccaccatgcggaccctgagcaaccccctcctgggctccttt
cagcagccctccagctacttcctgcctgccatgccccagcctccagcccaggctgcatac
tatggctgtggcccagtgacacccacccagcctgcccccaggtggacatcccagccacct
agaccttcctctgcctaccctccaggtgcctcaatggtccggccaccagttgtgcctcgg
cgccccccggcccacatcagcagtgtcaggcaggcctccacccaggtgccacgcacggtg
cctcatacccagagagtagccaacattggtactcagaccacaggacccagtggggtagga
tgctgtacaccaggccggccgctcctgccgtgcaaatgttcctcagcagcacatagcacc
tatcgggtccaggagccggctgtgcacatcccaggacaggagcccctgaccgcgtccatg
ctggctgcggcgcccctgcatgagcaaaagcagatgattggggagcgtctctaccccctt
atccatgatgtccacacccagctggctggcaagatcacgggcatgctgctggagattgac
aactcagagctgttgctcatgctggagtctccagaatccctccatgccaagatagacgag
gcagtggccgtgctgcaggcacaccaggctatggagcagccgaaggcgtacatgcactga

KEGG   Homo sapiens (human): 8761
Entry
8761              CDS       T01001                                 

Symbol
PABPC4, APP-1, APP1, PABP4, iPABP
Name
(RefSeq) poly(A) binding protein cytoplasmic 4
  KO
K13126  polyadenylate-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    8761 (PABPC4)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    8761 (PABPC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    8761 (PABPC4)
   03041 Spliceosome [BR:hsa03041]
    8761 (PABPC4)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     8761 (PABPC4)
   mRNA cycle factors
    Stress granule specific factors
     8761 (PABPC4)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   Complex C specific factors
    8761 (PABPC4)
SSDB
Motif
Pfam: RRM_1 PABP RRM_5 RRM_occluded RRM_3 ApbA_C
Other DBs
NCBI-GeneID: 8761
NCBI-ProteinID: NP_003810
OMIM: 603407
HGNC: 8557
Ensembl: ENSG00000090621
Vega: OTTHUMG00000009097
Pharos: Q13310(Tbio)
UniProt: Q13310
Position
1p34.3
AA seq 644 aa
MNAAASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQ
QPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFS
AFGNILSCKVVCDENGSKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKERE
AELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKSKGFGFVSYEK
HEDANKAVEEMNGKEISGKIIFVGRAQKKVERQAELKRKFEQLKQERISRYQGVNLYIKN
LDDTIDDEKLRKEFSPFGSITSAKVMLEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGS
KPLYVALAQRKEERKAHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRP
PYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSAIRQSGPRPTLRHLAPTGSECPDRLAMDF
GGAGAAQQGLTDSCQSGGVPTAVQNLAPRAAVAAAAPRAVAPYKYASSVRSPHPAIQPLQ
APQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNS
ELLHMLESPESLRSKVDEAVAVLQAHHAKKEAAQKVGAVAAATS
NT seq 1935 nt   +upstreamnt  +downstreamnt
atgaacgctgcggccagcagctaccccatggcctccctgtacgtgggcgacctgcattcg
gacgtcaccgaggccatgctgtacgaaaagttcagccccgcggggcctgtgctgtccatc
cgggtctgccgcgatatgatcacccgccgctccctgggctatgcctacgtcaacttccag
cagccggccgacgctgagcgggctttggacaccatgaactttgatgtgattaagggaaag
ccaatccgcatcatgtggtctcagagggatccctctttgagaaaatctggtgtgggaaac
gtcttcatcaagaacctggacaaatctatagataacaaggcactttatgatactttttct
gcttttggaaacatactgtcctgcaaggtggtgtgtgatgagaacggctctaagggttat
gcctttgtccacttcgagacccaagaggctgccgacaaggccatcgagaagatgaatggc
atgctcctcaatgaccgcaaagtatttgtgggcagattcaagtctcgcaaagagcgggaa
gctgagcttggagccaaagccaaggaattcaccaatgtttatatcaaaaactttggggaa
gaggtggatgatgagagtctgaaagagctattcagtcagtttggtaagaccctaagtgtc
aaggtgatgagagatcccaatgggaaatccaaaggctttggctttgtgagttacgaaaaa
cacgaggatgccaataaggctgtggaagagatgaatggaaaagaaataagtggtaaaatc
atatttgtaggccgtgcacaaaagaaagtagaacggcaggcagagttaaaacggaaattt
gaacagttgaaacaggagagaattagtcgatatcagggggtgaatctctacattaagaac
ttggatgacactattgatgatgagaaattaaggaaagaattttctccttttggatcaatt
accagtgctaaggtaatgctggaggatggaagaagcaaagggtttggcttcgtctgcttc
tcatctcctgaagaagcaaccaaagcagtcactgagatgaatggacgcattgtgggctcc
aagccactatatgttgccctggcccagaggaaggaagagagaaaggctcacctgaccaac
cagtatatgcaacgagtggctggaatgagagcacttcctgccaatgccatcttaaatcag
ttccagcctgcagcgggtggctactttgtgccagcagtcccacaggctcagggaaggcct
ccatattatacacctaaccagttagcacagatgaggcctaatccacgctggcagcaaggt
gggagacctcaaggcttccaaggaatgccaagtgctatacgccagtctgggcctcgtcca
actcttcgccatctggctccaactgggtctgagtgcccggaccgcttggctatggacttt
ggtggggctggtgccgcccagcaagggctgactgacagctgccagtctggaggcgttccc
acagctgtgcagaacttagcgccacgcgctgctgttgctgctgctgctccccgggctgtt
gccccctacaaatacgcctccagtgtccgcagccctcatcctgccatacagcctctgcag
gcaccccagcctgcggtccatgtgcaggggcaggagccactgactgcctccatgctggct
gcagcacccccccaggaacagaagcagatgctgggagaacgcttgttcccactcatccaa
acaatgcattcaaatctggctgggaagatcacgggaatgctgctggagatagacaactct
gagctgctgcacatgttagagtcccccgagtctctccgctccaaggtggatgaagctgta
gcagttctacaggctcatcatgccaagaaagaagctgcccagaaggtgggcgctgttgct
gctgctacctcttag

DBGET integrated database retrieval system