KEGG   Homo sapiens (human): 1326Help
Entry
1326              CDS       T01001                                 

Gene name
MAP3K8, AURA2, COT, EST, ESTF, MEKK8, TPL2, Tpl-2, c-COT
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 8
  KO
K04415  mitogen-activated protein kinase kinase kinase 8 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04668  TNF signaling pathway
Module
hsa_M00688  MAPK (JNK) signaling
hsa_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    1326 (MAP3K8)
   04668 TNF signaling pathway
    1326 (MAP3K8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    1326 (MAP3K8)
   04660 T cell receptor signaling pathway
    1326 (MAP3K8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1326 (MAP3K8)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     1326 (MAP3K8)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  Other
   1326 (MAP3K8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH HTH_8 RIO1 IML1
Motif
Other DBs
NCBI-GeneID: 1326
NCBI-ProteinID: NP_001231063
OMIM: 191195
HGNC: 6860
Ensembl: ENSG00000107968
Vega: OTTHUMG00000017889
Pharos: P41279(Tchem)
UniProt: P41279
Structure
PDB: 

Position
10p11.23
AA seq 467 aa AA seqDB search
MEYMSTGSDNKEEIDLLIKHLNVSDVIDIMENLYASEEPAVYEPSLMTMCQDSNQNDERS
KSLLLSGQEVPWLSSVRYGTVEDLLAFANHISNTAKHFYGQRPQESGILLNMVITPQNGR
YQIDSDVLLIPWKLTYRNIGSDFIPRGAFGKVYLAQDIKTKKRMACKLIPVDQFKPSDVE
IQACFRHENIAELYGAVLWGETVHLFMEAGEGGSVLEKLESCGPMREFEIIWVTKHVLKG
LDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVQMTEDVYFPKDLRGTEIYMSPEVIL
CRGHSTKADIYSLGATLIHMQTGTPPWVKRYPRSAYPSYLYIIHKQAPPLEDIADDCSPG
MRELIEASLERNPNHRPRAADLLKHEALNPPREDQPRCQSLDSALLERKRLLSRKELELP
ENIADSSCTGSTEESEMLKRQRSLYIDLGALAGYFNLVRGPPTLEYG
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggagtacatgagcactggaagtgacaataaagaagagattgatttattaattaaacat
ttaaatgtgtctgatgtaatagacattatggaaaatctttatgcaagtgaagagccagca
gtttatgaacccagtctaatgaccatgtgtcaagacagtaatcaaaacgatgagcgttct
aagtctctgctgcttagtggccaagaggtaccatggttgtcatcagtcagatatggaact
gtggaggatttgcttgcttttgcaaaccatatatccaacactgcaaagcatttttatgga
caacgaccacaggaatctggaattttattaaacatggtcatcactccccaaaatggacgt
taccaaatagattccgatgttctcctgatcccctggaagctgacttacaggaatattggt
tctgattttattcctcggggcgcctttggaaaggtatacttggcacaagatataaagacg
aagaaaagaatggcgtgtaaactgatcccagtagatcaatttaagccatctgatgtggaa
atccaggcttgcttccggcacgagaacatcgcagagctgtatggcgcagtcctgtggggt
gaaactgtccatctctttatggaagcaggcgagggagggtctgttctggagaaactggag
agctgtggaccaatgagagaatttgaaattatttgggtgacaaagcatgttctcaaggga
cttgattttctacactcaaagaaagtgatccatcatgatattaaacctagcaacattgtt
ttcatgtccacaaaagctgttttggtggattttggcctaagtgttcaaatgaccgaagat
gtctattttcctaaggacctccgaggaacagagatttacatgagcccagaggtcatcctg
tgcaggggccattcaaccaaagcagacatctacagcctgggggccacgctcatccacatg
cagacgggcaccccaccctgggtgaagcgctaccctcgctcagcctatccctcctacctg
tacataatccacaagcaagcacctccactggaagacattgcagatgactgcagtccaggg
atgagagagctgatagaagcttccctggagagaaaccccaatcaccgcccaagagccgca
gacctactaaaacatgaggccctgaacccgcccagagaggatcagccacgctgtcagagt
ctggactctgccctcttggagcgcaagaggctgctgagtaggaaggagctggaacttcct
gagaacattgctgattcttcgtgcacaggaagcaccgaggaatctgagatgctcaagagg
caacgctctctctacatcgacctcggcgctctggctggctacttcaatcttgttcgggga
ccaccaacgcttgaatatggctga

DBGET integrated database retrieval system