KEGG   Homo sapiens (human): 132660Help
Entry
132660            CDS       T01001                                 

Gene name
LIN54, CXCDC1, JC8.6, MIP120, TCX1
Definition
(RefSeq) lin-54 DREAM MuvB core complex component
  KO
K21776  protein lin-54
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    132660 (LIN54)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TCR MSL2-CXC
Motif
Other DBs
NCBI-GeneID: 132660
NCBI-ProteinID: NP_919258
OMIM: 613367
HGNC: 25397
Ensembl: ENSG00000189308
Vega: OTTHUMG00000130287
Pharos: Q6MZP7(Tdark)
UniProt: Q6MZP7 A0A024RDD8 Q7Z3G2
Structure
PDB: 

Position
4q21.22
AA seq 749 aa AA seqDB search
MEVVPAEVNSLLPEEIMDTGITLVDDDSIEAVIVSSPIPMETELEEIVNINSTGDSTATP
ISTEPITVYSNHTNQVAVNTTITKADSNTTVKPAFPSGLQKLGAQTPVTISANQIILNKV
SQTSDLKLGNQTLKPDGQKLILTTLGKSGSPIVLALPHSQLPQAQKVTTQAQSGDAKLPP
QQIKVVTIGGRPEVKPVIGVSALTPGSQLINTTTQPSVLQTQQLKTVQIAKKPRTPTSGP
VITKLIFAKPINSKAVTGQTTQVSPPVIAGRVLSQSTPGTPSKTITISESGVIGSTLNST
TQTPNKIAISPLKSPNKAVKSTVQTITVGGVSTSQFKTIIPLATAPNVQQIQVPGSKFHY
VRLVTATSASSSTQPVSQNPSTNTQPLQQAKPVVVNTTPVRMSVPIVSAQAVKQVVPKPI
NPTSQIVTTSQPQQRLIMPATPLPQIQPNLTNLPPGTVLAPAPGTGNVGYAVLPAQYVTQ
LQQSSYVSIASNSTFTGTSGIQTQARLPFNGIIPSESASRPRKPCNCTKSLCLKLYCDCF
ANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCN
CKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKT
KLSSQISDLLTRPTPALNSGGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAER
MILEEFGRCLMSVINSAGKAKSDPCAMNC
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggtgccagctgaggtgaatagtttgcttccagaggaaataatggacactggt
ataactttagtggatgatgatagtattgaggctgttattgtttcatccccaattcccatg
gagacagaactggaagaaattgtcaacataaattctactggtgactctacagccacgccc
atttccacggaaccaatcacagtgtacagtaaccacactaaccaagttgcagtgaatacc
acaattactaaagcagattctaataccacagtgaaaccagcttttccaagtggccttcaa
aaacttggtgctcagactcctgtgactatatcagccaatcagattattttaaacaaagta
tcacagacatctgatcttaaacttggcaatcagacccttaaaccagatggacagaagtta
attttaacaactttgggcaagtctggttcaccaattgttttagcactaccccatagccaa
ctaccccaggctcagaaagttacaactcaggcccagtcaggagatgctaagttaccaccg
cagcaaattaaagtagttaccattggagggaggccagaggtgaaacctgtcattggtgtc
tcagcattgaccccaggaagtcaactgattaatactacaactcagccctctgtgttacag
acccaacagttaaaaacagtacagattgctaagaagcctcgaacgccaacctctggtcca
gtaatcacgaagctgatctttgcaaaaccaattaatagtaaagcagttacaggacagaca
actcaagtttcaccaccagttattgcaggtagggttctttcacagtctactcccggaact
ccatcaaagaccataacaatatctgaaagtggtgttattggatcaactttaaattctaca
acacagacaccaaataaaatagccatctcacctttgaaatcgccaaataaggcagtgaaa
tcaactgtgcagaccatcactgttggaggagtgagcacatcacagtttaagacaattatt
cctctggcaactgctcccaatgtccagcagattcaagtgcctggaagcaagtttcattat
gtccgacttgttactgccacatcagccagtagctcaacccagccagttagtcagaatccc
agtacaaacactcagcctcttcagcaagcaaagccagtggttgttaatacaaccccagtg
cggatgtcagttccaattgtctcagctcaggctgtcaaacaagttgttccaaaaccaatc
aatccaacttcacaaatagtaactactagccagccacagcaacggcttatcatgcctgcc
acaccactgccacagatccagcccaacctcactaacctgccaccaggcactgtcctggca
ccagctccgggaacagggaatgtgggttatgcagtgcttccagctcagtatgttactcag
ctacagcagtcttcatatgtatcaatagcaagcaactctacctttactggaacatctggt
atccagacccaggcacggcttccattcaatggcataatcccatcagagtcggccagtcgg
ccccgaaagccctgtaattgtacaaaatcactgtgtttgaaattgtattgtgattgcttt
gcaaatggtgaattttgcaacaactgcaattgtactaattgttacaacaatttggaacat
gaaaatgaaaggcaaaaagcaataaaggcatgccttgacagaaatccagaagcctttaag
cctaagatagggaaaggaaaggagggagaatctgatcgacgtcatagcaaagggtgtaat
tgcaaacgatcaggatgtcttaaaaactactgtgaatgctatgaggcaaaaataatgtgt
tcctcaatatgcaaatgtattggctgtaagaattttgaagaaagcccggaaaggaagaca
ttgatgcatttggcagatgcagctgaagtaagggtacagcaacaaacagcagccaagacg
aagttatcctctcaaatttcagacttgcttactaggccaacaccagctttaaatagtgga
ggcggaaaattgccatttacatttgtaactaaggaagtagctgaagccacatgtaattgc
ctccttgcccaggcagagcaggcagacaagaagggaaaatcaaaggcagcagcggaacgg
atgatacttgaggaattcggacgatgtttgatgagtgtcatcaactctgcaggaaaggca
aaaagtgacccttgtgccatgaattgctaa

DBGET integrated database retrieval system