KEGG   Homo sapiens (human): 1327
Entry
1327              CDS       T01001                                 
Symbol
COX4I1, COX_IV-1, COX4, COX4-1, COXIV, COXIV-1, MC4DN16
Name
(RefSeq) cytochrome c oxidase subunit 4I1
  KO
K02263  cytochrome c oxidase subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06252  Mitochondrial ROS formation
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
N01394  Arsenic to electron transfer in complex IV
Disease
H01368  Cytochrome c oxidase (COX) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1327 (COX4I1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1327 (COX4I1)
  09159 Environmental adaptation
   04714 Thermogenesis
    1327 (COX4I1)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    1327 (COX4I1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1327 (COX4I1)
   05012 Parkinson disease
    1327 (COX4I1)
   05014 Amyotrophic lateral sclerosis
    1327 (COX4I1)
   05016 Huntington disease
    1327 (COX4I1)
   05020 Prion disease
    1327 (COX4I1)
   05022 Pathways of neurodegeneration - multiple diseases
    1327 (COX4I1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    1327 (COX4I1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1327 (COX4I1)
SSDB
Motif
Pfam: COX4
Other DBs
NCBI-GeneID: 1327
NCBI-ProteinID: NP_001305715
OMIM: 123864
HGNC: 2265
Ensembl: ENSG00000131143
Pharos: P13073(Tbio)
UniProt: P13073 Q86WV2
Structure
Position
16:85799695..85807068
AA seq 169 aa
MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQK
ALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMW
QKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
NT seq 510 nt   +upstreamnt  +downstreamnt
atgttggctaccagggtatttagcctagttggcaagcgagcaatttccacctctgtgtgt
gtacgagctcatgaaagtgttgtgaagagcgaagacttttcgctcccagcttatatggat
cggcgtgaccaccccttgccggaggtggcccatgtcaagcacctgtctgccagccagaag
gcattgaaggagaaggagaaggcctcctggagcagcctctccatggatgagaaagtcgag
ttgtatcgcattaagttcaaggagagctttgctgagatgaacaggggctcgaacgagtgg
aagacggttgtgggcggtgccatgttcttcatcggtttcaccgcgctcgttatcatgtgg
cagaagcactatgtgtacggccccctcccgcaaagctttgacaaagagtgggtggccaag
cagaccaagaggatgctggacatgaaggtgaaccccatccagggcttagcctccaagtgg
gactacgaaaagaacgagtggaagaagtga

DBGET integrated database retrieval system