KEGG   Homo sapiens (human): 132724Help
Entry
132724            CDS       T01001                                 

Gene name
TMPRSS11B
Definition
(RefSeq) transmembrane serine protease 11B
  KO
K09751  transmembrane protease serine 11B [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    132724 (TMPRSS11B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     132724 (TMPRSS11B)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   132724 (TMPRSS11B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SEA DUF1986 LapA_dom
Motif
Other DBs
NCBI-GeneID: 132724
NCBI-ProteinID: NP_872308
HGNC: 25398
Ensembl: ENSG00000185873
Vega: OTTHUMG00000129301
Pharos: Q86T26(Tdark)
UniProt: Q86T26
Position
4q13.2
AA seq 416 aa AA seqDB search
MYRHGISSQRSWPLWTTIFIFLGVAAILGVTIGLLVHFLAVEKTYYYQGDFHISGVTYND
NCENAASQASTNLSKDIETKMLNAFQNSSIYKEYVKSEVIKLLPNANGSNVQLQLKFKFP
PAEGVSMRTKIKAKLHQMLKNNMASWNAVPASIKLMEISKAASEMLTNNCCGRQVANSII
TGNKIVNGKSSLEGAWPWQASMQWKGRHYCGASLISSRWLLSAAHCFAKKNNSKDWTVNF
GIVVNKPYMTRKVQNIIFHENYSSPGLHDDIALVQLAEEVSFTEYIRKICLPEAKMKLSE
NDNVVVTGWGTLYMNGSFPVILQEDFLKIIDNKICNASYAYSGFVTDTMLCAGFMSGEAD
ACQNDSGGPLAYPDSRNIWHLVGIVSWGDGCGKKNKPGVYTRVTSYRNWITSKTGL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgtacaggcacggcatatcttcccaaagatcttggccactatggactacgatctttatt
tttcttggagtggcggcaatcttgggagtaaccattggtcttcttgttcattttctggca
gttgagaagacttactattatcaaggtgattttcatatttctggagtcacatacaatgat
aattgtgaaaacgcagcttcacaagccagcacaaatctaagcaaagatattgagactaag
atgttaaatgcatttcaaaattccagtatatataaggaatatgtcaaatctgaggtcatc
aaacttctgcctaatgccaatggttcaaatgtgcagttacagctgaaattcaagtttcct
ccagcagaaggagttagcatgaggactaaaatcaaggctaaattacatcagatgttgaaa
aacaacatggcatcctggaatgcagttcctgcttccattaaactcatggaaatcagcaag
gctgcttctgaaatgcttaccaacaactgttgtgggagacaagtagccaacagtatcata
actggcaacaaaattgtgaatggaaaaagctccctggagggggcatggccatggcaggcc
agcatgcaatggaaaggccgtcactactgtggagcctctctgatcagcagcaggtggcta
ttatctgcagctcactgctttgctaagaaaaataattcaaaagattggactgtcaacttt
ggaattgtagtaaataaaccatatatgacacggaaagtccaaaacattatttttcatgaa
aattatagcagtcctgggcttcatgatgatattgcccttgtgcagcttgctgaagaagtt
tcttttacagagtacattcgtaagatttgtcttcctgaagccaaaatgaagctctcagaa
aatgacaatgttgtagttacaggttggggaacactttatatgaatggttcatttccagtg
atacttcaagaagactttttgaagattattgacaacaaaatttgcaatgcctcatatgca
tactctggctttgtgactgatacaatgttatgtgctggatttatgtcaggagaagctgat
gcatgtcagaatgattctggtggaccactagcttaccctgattccagaaatatctggcat
cttgttggaatagtaagctggggtgatggatgtggtaaaaagaataagccaggtgtctat
actcgagtgacttcttatcgcaattggattacatccaagactggactctga

DBGET integrated database retrieval system