KEGG   Homo sapiens (human): 132949
Entry
132949            CDS       T01001                                 

Gene name
AASDH, ACSF4, LYS2, NRPS1098, NRPS998
Definition
(RefSeq) aminoadipate-semialdehyde dehydrogenase
  KO
K00142  acyl-CoA synthetase [EC:6.2.1.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    132949 (AASDH)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     132949 (AASDH)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Unknown
   132949 (AASDH)
SSDB
Motif
Pfam: AMP-binding PQQ_3 PQQ PQQ_2 PP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 132949
NCBI-ProteinID: NP_861522
OMIM: 614365
HGNC: 23993
Ensembl: ENSG00000157426
Vega: OTTHUMG00000128841
Pharos: Q4L235(Tdark)
UniProt: Q4L235 B4E2K0
Position
4q12
AA seq 1098 aa
MTLQELVHKAASCYMDRVAVCFDECNNQLPVYYTYKTVVNAASELSNFLLLHCDFQGIRE
IGLYCQPGIDLPSWILGILQVPAAYVPIEPDSPPSLSTHFMKKCNLKYILVEKKQINKFK
SFHETLLNYDTFTVEHNDLVLFRLHWKNTEVNLMLNDGKEKYEKEKIKSISSEHVNEEKA
EEHMDLRLKHCLAYVLHTSGTTGIPKIVRVPHKCIVPNIQHFRVLFDITQEDVLFLASPL
TFDPSVVEIFLALSSGASLLIVPTSVKLLPSKLASVLFSHHRVTVLQATPTLLRRFGSQL
IKSTVLSATTSLRVLALGGEAFPSLTVLRSWRGEGNKTQIFNVYGITEVSSWATIYRIPE
KTLNSTLKCELPVQLGFPLLGTVVEVRDTNGFTIQEGSGQVFLGGRNRVCFLDDEVTVPL
GTMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRLNIELVQQVAEELQQVESCAVTWYNQE
KLILFMVSKDASVKEYIFKELQKYLPSHAVPDELVLIDSLPFTSHGKIDVSELNKIYLNY
INLKSENKLSGKEDLWEKLQYLWKSTLNLPEDLLRVPDESLFLNSGGDSLKSIRLLSEIE
KLVGTSVPGLLEIILSSSILEIYNHILQTVVPDEDVTFRKSCATKRKLSDINQEEASGTS
LHQKAIMTFTCHNEINAFVVLSRGSQILSLNSTRFLTKLGHCSSACPSDSVSQTNIQNLK
GLNSPVLIGKSKDPSCVAKVSEEGKPAIGTQKMELHVRWRSDTGKCVDASPLVVIPTFDK
SSTTVYIGSHSHRMKAVDFYSGKVKWEQILGDRIESSACVSKCGNFIVVGCYNGLVYVLK
SNSGEKYWMFTTEDAVKSSATMDPTTGLIYIGSHDQHAYALDIYRKKCVWKSKCGGTVFS
SPCLNLIPHHLYFATLGGLLLAVNPATGNVIWKHSCGKPLFSSPQCCSQYICIGCVDGNL
LCFTHFGEQVWQFSTSGPIFSSPCTSPSEQKIFFGSHDCFIYCCNMKGHLQWKFETTSRV
YATPFAFHNYNGSNEMLLAAASTDGKVWILESQSGQLQSVYELPGEVFSSPVVLESMLII
GCRDNYVYCLDLLGGNQK
NT seq 3297 nt   +upstreamnt  +downstreamnt
atgactcttcaggaattggtgcataaggctgcctcctgttatatggacagagtagctgta
tgttttgatgaatgcaacaaccagcttccagtttactacacctacaagactgtggttaat
gctgcttctgaattatcaaattttctgctgttacactgtgactttcaaggaattcgggaa
attggtctctactgccaacctgggatagacttaccctcttggattttaggaattctccaa
gtcccggctgcttatgtacctatcgagccagattcaccaccgtcattatcaactcatttt
atgaaaaaatgtaatctaaagtatatccttgttgaaaaaaaacaaattaataaatttaaa
tcttttcatgaaacattattgaactatgatacatttacagtggaacataatgacctagtg
ctcttcagacttcactggaaaaatactgaggtgaacttgatgctaaatgatggaaaagag
aaatatgaaaaagaaaaaataaaaagcataagttctgagcatgtcaatgaagaaaaagca
gaagaacacatggatctgaggctaaagcattgcttagcctatgttctacatacatcaggg
actacagggataccgaagattgtcagagtgcctcataagtgtatagtaccaaatatccag
cattttcgggtactttttgacatcacacaagaagatgttttgtttctggcttcacctctg
accttcgatccttctgttgtggaaatatttcttgctctatcaagtggtgcctctctgctt
attgtaccaacttccgtcaagttgctcccatcaaaattagccagcgttctcttttcccat
catagagtgactgttttgcaggcaacaccaacattgcttagaagatttggatctcagctt
atcaagtcaactgttttgtcagccactacttctcttcgagtattagcccttggtggtgaa
gcgtttccatcattgacagttctcagaagctggagaggagaaggcaataaaacacaaata
tttaatgtttatggtatcacagaggtatcaagttgggcgaccatttataggattccagag
aagactcttaactctactctcaaatgtgaattgcctgtacaactgggatttccacttctt
ggaacagtagttgaagtcagagatactaatggcttcacaattcaggaaggcagtggccaa
gtatttttaggtggcagaaacagagtgtgttttcttgatgatgaagtgacagtaccactt
ggcacaatgcgagctacaggagactttgtgactgtgaaagatggagagattttttttttg
ggacgaaaagacagtcagatcaaacgtcatggcaaacgtcttaacattgaacttgtgcaa
caggttgctgaagagcttcagcaagtggagtcttgtgcagttacatggtataatcaggaa
aaattaattctcttcatggtgtctaaagatgcttcagtaaaagaatacatctttaaagaa
ctgcagaaatatcttccaagtcatgcagtcccggatgagcttgtattgatcgactctcta
ccatttacatcccacggcaaaattgatgtttctgagttaaacaagatatatttaaactac
ataaacttgaagtctgagaataagctcagtgggaaagaggacctttgggaaaaattacag
tatttgtggaagtctactctgaatctcccagaagatcttttgagggttcctgatgagtca
ctcttcttaaatagtggtggagattccttaaagtccatccggctcctcagtgagattgaa
aaacttgttggtacatcagtacctgggcttctggaaattattctcagcagttccatttta
gagatttataatcacatccttcaaacagtggttccagatgaagatgtgacattcaggaag
agttgtgccacaaaaaggaaactcagcgacattaatcaagaggaagccagtggaacatct
ttacatcagaaagccatcatgactttcacttgccacaatgagattaatgcttttgttgta
ctgagcagagggagtcaaattttgtctctgaattccactaggtttttaacaaagttagga
cattgctcttcagcctgtccttctgactcagtttcacagaccaacattcaaaatttgaaa
ggcttaaattctccagttcttattgggaagtcaaaagatccatcctgtgttgcaaaagtt
tctgaagaggggaaacctgcgatagggactcagaaaatggagttacatgtgaggtggagg
tcagacacaggcaaatgtgtagatgcttcaccgctggttgtaatacccacttttgataag
tcatctacaactgtgtacattggttcccattctcatagaatgaaggcagttgacttttac
tctgggaaggtaaaatgggaacagattttgggagatcgaattgaatcctcagcatgtgta
tctaagtgtggaaactttattgtggtgggctgttataatggattagtttatgttctgaaa
agtaatagtggagaaaaatactggatgtttactactgaagatgctgtcaaaagctcggca
accatggatccaaccacaggactcatttacattggatctcatgaccagcacgcatatgct
ttagatatttatagaaagaagtgtgtttggaagtcaaaatgtggaggaactgtcttttcc
tctccgtgtttgaacctgattccacatcatttgtattttgctacattgggaggactttta
ctggctgtaaatcctgctactgggaacgttatttggaaacattcctgtggaaaaccactc
ttctcttccccacaatgttgctcacagtatatttgtattggctgtgtagatgggaattta
ctctgctttactcactttggagaacaggtttggcagttctctaccagtggaccaatcttt
tcatccccgtgtacctcaccatcagagcaaaaaatattttttggttcccatgattgcttt
atctactgttgtaacatgaaaggtcacctgcagtggaaatttgaaactacttcaagggtc
tatgcaacaccgtttgctttccataactacaatggcagcaatgaaatgttgctggcagca
gcatctactgatgggaaagtgtggatcttggaatctcagagtggacaattgcaaagtgtt
tatgaacttcctggagaagtcttctcttctcctgtggtcctggaatcaatgctcattatt
gggtgtagagataattatgtttattgtctggatttattgggtggcaatcaaaaataa

DBGET integrated database retrieval system