KEGG   Homo sapiens (human): 133121
Entry
133121            CDS       T01001                                 

Gene name
ENPP6, NPP6
Definition
(RefSeq) ectonucleotide pyrophosphatase/phosphodiesterase 6
  KO
K08743  ectonucleotide pyrophosphatase/phosphodiesterase family member 6 [EC:3.1.4.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00565  Ether lipid metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    133121 (ENPP6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    133121 (ENPP6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.-  
     133121 (ENPP6)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  133121 (ENPP6)
SSDB
Motif
Pfam: Phosphodiest Metalloenzyme PglZ Sulfatase
Other DBs
NCBI-GeneID: 133121
NCBI-ProteinID: NP_699174
OMIM: 616983
HGNC: 23409
Ensembl: ENSG00000164303
Vega: OTTHUMG00000160617
Pharos: Q6UWR7(Tbio)
UniProt: Q6UWR7
Position
4q35.1
AA seq 440 aa
MAVKLGTLLLALALGLAQPASARRKLLVFLLDGFRSDYISDEALESLPGFKEIVSRGVKV
DYLTPDFPSLSYPNYYTLMTGRHCEVHQMIGNYMWDPTTNKSFDIGVNKDSLMPLWWNGS
EPLWVTLTKAKRKVYMYYWPGCEVEILGVRPTYCLEYKNVPTDINFANAVSDALDSFKSG
RADLAAIYHERIDVEGHHYGPASPQRKDALKAVDTVLKYMTKWIQERGLQDRLNVIIFSD
HGMTDIFWMDKVIELNKYISLNDLQQVKDRGPVVSLWPAPGKHSEIYNKLSTVEHMTVYE
KEAIPSRFYYKKGKFVSPLTLVADEGWFITENREMLPFWMNSTGRREGWQRGWHGYDNEL
MDMRGIFLAFGPDFKSNFRAAPIRSVDVYNVMCNVVGITPLPNNGSWSRVMCMLKGRAST
APPVWPSHCALALILLFLLA
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggcagtgaagcttgggaccctcctgctggcccttgccctgggcctggcccagccagcc
tctgcccgccggaagctgctggtgtttctgctggatggttttcgctcagactacatcagt
gatgaggcgctggagtcattgcctggtttcaaagagattgtgagcaggggagtaaaagtg
gattacttgactccagacttccctagtctctcgtatcccaattattataccctaatgact
ggccgccattgtgaagtccatcagatgatcgggaactacatgtgggaccccaccaccaac
aagtcctttgacattggcgtcaacaaagacagcctaatgcctctctggtggaatggatca
gaacctctgtgggtcactctgaccaaggccaaaaggaaggtctacatgtactactggcca
ggctgtgaggttgagattctgggtgtcagacccacctactgcctagaatataaaaatgtc
ccaacggatatcaattttgccaatgcagtcagcgatgctcttgactccttcaagagtggc
cgggccgacctggcagccatataccatgagcgcattgacgtggaaggccaccactacggg
cctgcatctccgcagaggaaagatgccctcaaggctgtagacactgtcctgaagtacatg
accaagtggatccaggagcggggcctgcaggaccgcctgaacgtcattattttctcggat
cacggaatgaccgacattttctggatggacaaagtgattgagctgaataagtacatcagc
ctgaatgacctgcagcaagtgaaggaccgcgggcctgttgtgagcctttggccggcccct
gggaaacactctgagatatataacaaactgagcacagtggaacacatgactgtctacgag
aaagaagccatcccaagcaggttctattacaagaaaggaaagtttgtctctcctttgact
ttagtggctgatgaaggctggttcataactgagaatcgagagatgcttccgttttggatg
aacagcaccggcaggcgggaaggttggcagcgtggatggcacggctacgacaacgagctc
atggacatgcggggcatcttcctggccttcggacctgatttcaaatccaacttcagagct
gctcctatcaggtcggtggacgtctacaatgtcatgtgcaatgtggtgggcatcaccccg
ctgcccaacaacggatcctggtccagggtgatgtgcatgctgaagggccgcgccagcact
gccccgcctgtctggcccagccactgtgccctggcactgattcttctcttcctgcttgca
taa

DBGET integrated database retrieval system